Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
TVTATRILKGQ3.1.3.1;Alkaline phosphatase. 67 -
LGPETPLAMD3.1.3.1;Alkaline phosphatase. 82 -
LAMDRFP3.1.3.1;Alkaline phosphatase. 88 -
TATAYLCGVK3.1.3.1;Alkaline phosphatase. 114 -
SAAARFNQCN3.1.3.1;Alkaline phosphatase. 132 -
TTRGNEV3.1.3.1;Alkaline phosphatase. 142 -
GVVTTTR3.1.3.1;Alkaline phosphatase. 163 -
GGGRKYM3.1.3.1;Alkaline phosphatase. 220 -
GTPDPEYP3.1.3.1;Alkaline phosphatase. 230 -
NLVQEWL3.1.3.1;Alkaline phosphatase. 251 -
LMGLFEP3.1.3.1;Alkaline phosphatase. 284 -
GLFEPGD3.1.3.1;Alkaline phosphatase. 286 -
VEGGRID3.1.3.1;Alkaline phosphatase. 329
  • Metal Site E=Glutamic acid at location 330 on the protein
  • Metal Site Description: Magnesium (By similarity).
ALTEAVMFD3.1.3.1;Alkaline phosphatase. 346 -
VTADHSHVF3.1.3.1;Alkaline phosphatase. 373
  • Metal Site D=Aspartic acid at location 376 on the protein
  • Metal Site Description: Zinc 2 (Potential).
LYGNGPGY3.1.3.1;Alkaline phosphatase. 411 -
VPLSSETH3.1.3.1;Alkaline phosphatase. 444 -
ETHGGEDVA3.1.3.1;Alkaline phosphatase. 449
  • Metal Site H=Histidine at location 451 on the protein
  • Metal Site Description: Zinc 1 (By similarity).
FARGPQAHL3.1.3.1;Alkaline phosphatase. 459 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MQGPWVLLLLGLRLQLSLGVIPAEEENPAFWNRQAAEALDAAKKLQPIQKVAKNLILFLGDGLGVPTVTATRILKGQKNGKLGPETPLAMDRFPYLALSK
TYNVDRQVPDSAA
TATAYLCGVKANFQTIGLSAAARFNQCNTTRGNEVISVMNRAKQAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADMPASARQE
GCQDIATQLISNMDIDVIL
GGGRKYMFPMGTPDPEYPADASQNGIRLDGKNLVQEWLAKHQGAWYVWNRTELMQASLDQSVTHLMGLFEPGDTKYEIHRD
PTLDPSLMEMTEAALRLLSRNPRGFYLF
VEGGRIDHGHHEGVAYQALTEAVMFDDAIERAGQLTSEEDTLTLVTADHSHVFSFGGYTLRGSSIFGLAPSK
AQDSKAYTSI
LYGNGPGYVFNSGVRPDVNESESGSPDYQQQAAVPLSSETHGGEDVAVFARGPQAHLVHGVQEQSFVAHVMAFAACLEPYTACDLAPPAC
TTDAAHPVAASLPLLAGTLLLLGASAAP



DME EC Prediction for this protein is: 3.1.3.1
Check another protein