Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
NHWQEDLMFGYQFLNGCNPVLI1.13.11.34;Arachidonate 5-lipoxygenase. 225
  • Domain: Lipoxygenase
  • Gene: LOX5
FGYQFLNG1.13.11;With incorporation of two atoms of oxygen. 233
  • Domain: Lipoxygenase
NPVLIRRC1.13.11;With incorporation of two atoms of oxygen. 242
  • Domain: Lipoxygenase
KLPVTTEMVECSLER1.13.11.34;Arachidonate 5-lipoxygenase. 255
  • Domain: Lipoxygenase
  • Gene: LOX5
ELLDGIDANKTDPCT1.13.11.34;Arachidonate 5-lipoxygenase. 288
  • Domain: Lipoxygenase
  • Gene: LOX5
QFLAAPICLLYKNLANKIVPIAIQLNQ1.13.11.34;Arachidonate 5-lipoxygenase. 304
  • Domain: Lipoxygenase
  • Gene: LOX5
WVRSSDF1.13.11;With incorporation of two atoms of oxygen. 354
  • Domain: Lipoxygenase
GLFDKANATGGGGHVQMVQRA1.13.11.34;Arachidonate 5-lipoxygenase. 420
  • Domain: Lipoxygenase
  • Gene: LOX5
SLCFPEAIKARGM1.13.11.34;Arachidonate 5-lipoxygenase. 448
  • Domain: Lipoxygenase
  • Gene: LOX5
YRDDGLLVW1.13.11;With incorporation of two atoms of oxygen. 471
  • Domain: Lipoxygenase
VIFTASAQHAAVNF1.13.11;With incorporation of two atoms of oxygen. 543
  • Metal Site H=Histidine at location 551 on the protein
  • Metal Site Description: Iron; catalytic (By similarity
  • Domain: Lipoxygenase
HAAVNFGQY1.13.11;With incorporation of two atoms of oxygen. 551
  • Metal Site H=Histidine at location 551 on the protein
  • Metal Site Description: Iron; catalytic (By similarity
  • Domain: Lipoxygenase
TAKGVVTIEQIV1.13.11.34;Arachidonate 5-lipoxygenase. 578
  • Domain: Lipoxygenase
  • Gene: LOX5
TLPDRGRSCWHLGAVWALSQFQENELFLGMYPEEHFIEKP1.13.11.34;Arachidonate 5-lipoxygenase. 591
  • Domain: Lipoxygenase
  • Gene: LOX5

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MPSYTVTVATGSQWFAGTDDYIYLSLVGSAGCSEKHLLDKPFYNDFERGAVDSYDVTVDEELGEIQLVRIEKRKYWLNDDWYLKYITLKTPHGDYIEFPC
YRWITGDVEVVLRDGRAKLARDDQIHILKQHRRKELETRQKQYRWMEWNPGFPLSIDAKCHKDLPRDIQFDSEKGVDFVLNYSKAMENLFINRFMHMFQS
SWNDFADFEKIFVKISNTISERVM
NHWQEDLMFGYQFLNGCNPVLIRRCTELPEKLPVTTEMVECSLERQLSLEQEVQQGNIFIVDFELLDGIDANKTDP
CT
LQFLAAPICLLYKNLANKIVPIAIQLNQIPGDENPIFLPSDAKYDWLLAKIWVRSSDFHVHQTITHLLRTHLVSEVFGIAMYRQLPAVHPIFKLLVAH
VRFTIAINTKAREQLICEC
GLFDKANATGGGGHVQMVQRAMKDLTYASLCFPEAIKARGMESKEDIPYYFYRDDGLLVWEAIRTFTAEVVDIYYEGDQVV
EEDPELQDFVNDVYVYGMRGRKSSGFPKSVKSREQLSEYLTV
VIFTASAQHAAVNFGQYDWCSWIPNAPPTMRAPPPTAKGVVTIEQIVDTLPDRGRSCW
HLGAVWALSQFQENELFLGMYPEEHFIEKP
VKEAMARFRKNLEAIVSVIAERNKKKQLPYYYLSPDRIPNSVAI



DME EC Prediction for this protein is: 1.13.11.34
Check another protein