Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
ESIPKDS2.4.2.30;NAD(+) ADP-ribosyltransferase. 26
  • Gene: PARP1
SPMFDGK2.4.2.30;NAD(+) ADP-ribosyltransferase. 41
  • Gene: PARP1
GFSELRWDDQQ2.4.2.30;NAD(+) ADP-ribosyltransferase. 73
  • Gene: PARP1
DFAAEYAKSNRSTCKGC2.4.2.30;NAD(+) ADP-ribosyltransferase. 112
  • Gene: PARP1
PQLGMIDRWYHP2.4.2.30;NAD(+) ADP-ribosyltransferase. 149
  • Gene: PARP1
YSASQLKGF2.4.2.30;NAD(+) ADP-ribosyltransferase. 176
  • Gene: PARP1
KRKGDEVDG2.4.2.30;NAD(+) ADP-ribosyltransferase. 207
  • Gene: PARP1
DEVAKKKS2.4.2.30;NAD(+) ADP-ribosyltransferase. 217
  • Gene: PARP1
QQVPSGE2.4.2.30;NAD(+) ADP-ribosyltransferase. 270
  • Gene: PARP1
VPSGESAILDRVADGM2.4.2.30;NAD(+) ADP-ribosyltransferase. 272
  • Gene: PARP1
DAYYCTGD2.4.2.30;NAD(+) ADP-ribosyltransferase. 307
  • Gene: PARP1
WVTPKEF2.4.2.30;NAD(+) ADP-ribosyltransferase. 333
  • Gene: PARP1
KKQDRIFPPE2.4.2.30;NAD(+) ADP-ribosyltransferase. 351
  • Gene: PARP1
NMKILTLGKLS2.4.2.30;NAD(+) ADP-ribosyltransferase. 392
  • Domain: BRCT
  • Gene: PARP1
MIEKLGG2.4.2;Pentosyltransferases. 411 -
SPWGAEVK2.4.2.30;NAD(+) ADP-ribosyltransferase. 479
  • Gene: PARP1
AVDPDSGLE2.4.2.30;NAD(+) ADP-ribosyltransferase. 532 -
GTNSYYKLQL2.4.2.30;NAD(+) ADP-ribosyltransferase. 565
  • Gene: PARP1
YWIFRSWGR2.4.2.30;NAD(+) ADP-ribosyltransferase. 583 -
GTVIGSNKLEQMPSKE2.4.2.30;NAD(+) ADP-ribosyltransferase. 593
  • Gene: PARP1
LYEEKTGN2.4.2.30;NAD(+) ADP-ribosyltransferase. 617
  • Gene: PARP1
KTGNAWHS2.4.2.30;NAD(+) ADP-ribosyltransferase. 621
  • Gene: PARP1
NFTKYPKKFYPLEIDYGQ2.4.2.30;NAD(+) ADP-ribosyltransferase. 630
  • Gene: PARP1
EIDLQKMPLGKLSKRQIQ2.4.2.30;NAD(+) ADP-ribosyltransferase. 690
  • Domain: PARP alpha-helical
  • Gene: PARP1
RQIQAAYSILSEVQQ2.4.2.30;NAD(+) ADP-ribosyltransferase. 704
  • Domain: PARP alpha-helical
  • Gene: PARP1
FYTLIPHDFGMKKPPLLNN2.4.2.30;NAD(+) ADP-ribosyltransferase. 736
  • Domain: PARP alpha-helical
  • Gene: PARP1
SVQAKVEMLDNLLDIEVAYSLLRGGSDDSSKDPIDVNYE2.4.2.30;NAD(+) ADP-ribosyltransferase. 757
  • Domain: PARP alpha-helical
  • Gene: PARP1
NYEKLKT2.4.2.30;NAD(+) ADP-ribosyltransferase. 793
  • Domain: PARP catalytic
  • Gene: PARP1
KTDIKVV2.4.2.30;NAD(+) ADP-ribosyltransferase. 798
  • Domain: PARP catalytic
  • Gene: PARP1
YVKNTHA2.4.2.30;NAD(+) ADP-ribosyltransferase. 817
  • Domain: PARP catalytic
THNAYDL2.4.2.30;NAD(+) ADP-ribosyltransferase. 825
  • Domain: PARP catalytic
  • Gene: PARP1
QRYKPFKQLHNR2.4.2.30;NAD(+) ADP-ribosyltransferase. 846
  • Domain: PARP catalytic
  • Gene: PARP1
NRRLLWHGS2.4.2.30;NAD(+) ADP-ribosyltransferase. 856
  • Domain: PARP catalytic
LLWHGSR2.4.2.30;NAD(+) ADP-ribosyltransferase. 859
  • Domain: PARP catalytic
GKGIYFA2.4.2.30;NAD(+) ADP-ribosyltransferase. 892
  • Domain: PARP catalytic
KLPKGKHSVKGLG2.4.2.30;NAD(+) ADP-ribosyltransferase. 940
  • Domain: PARP catalytic
  • Gene: PARP1
YNEYIVY2.4.2.30;NAD(+) ADP-ribosyltransferase. 986
  • Domain: PARP catalytic

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MAESSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHSIRHPDVEVDGFSELRWDDQQKVKKTAEAGGVTGKGQD
GIGSKAEKTLG
DFAAEYAKSNRSTCKGCMEKIEKGQVRLSKKMVDPEKPQLGMIDRWYHPGCFVKNREELGFRPEYSASQLKGFSLLATEDKEALKKQLP
GVKSEG
KRKGDEVDGVDEVAKKKSKKEKDKDSKLEKALKAQNDLIWNIKDELKKVCSTNDLKELLIFNKQQVPSGESAILDRVADGMVFGALLPCEECSG
QLVFKS
DAYYCTGDVTAWTKCMVKTQTPNRKEWVTPKEFREISYLKKLKVKKQDRIFPPETSASVAATPPPSTASAPAAVNSSASADKPLSNMKILTLGK
LS
RNKDEVKAMIEKLGGKLTGTANKASLCISTKKEVEKMNKKMEEVKEANIRVVSEDFLQDVSASTKSLQELFLAHILSPWGAEVKAEPVEVVAPRGKSG
AALSKKSKGQVKEEGINKSEKRMKLTLKGGA
AVDPDSGLEHSAHVLEKGGKVFSATLGLVDIVKGTNSYYKLQLLEDDKENRYWIFRSWGRVGTVIGSNK
LEQMPSKE
DAIEHFMKLYEEKTGNAWHSKNFTKYPKKFYPLEIDYGQDEEAVKKLTVNPGTKSKLPKPVQDLIKMIFDVESMKKAMVEYEIDLQKMPLGK
LSKRQIQAAYSILSEVQQ
AVSQGSSDSQILDLSNRFYTLIPHDFGMKKPPLLNNADSVQAKVEMLDNLLDIEVAYSLLRGGSDDSSKDPIDVNYEKLKTD
IKVV
DRDSEEAEIIRKYVKNTHATTHNAYDLEVIDIFKIEREGECQRYKPFKQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM
VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHIS
KLPKGKHSVKGLGKTTPDPSANISLDGVDVPLGTGISSGVNDTSLLYNEYIVYDIAQVNLK
YLLKLKFNFKTSLW



DME EC Prediction for this protein is: 2.4.2.30
Check another protein