Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
LGYWDIRG2.5.1.18;Glutathione transferase. 5
  • Active Site Y=Tyrosine at location 7 on the protein
  • Active Site Description: By similarity.
  • Domain: GST N-terminal
IRLLLEYT2.5.1.18;Glutathione transferase. 17
  • Domain: GST N-terminal
APDYDRSQWL2.5.1.18;Glutathione transferase. 38
  • Domain: GST N-terminal
WLNEKFK2.5.1.18;Glutathione transferase. 46
  • Domain: GST N-terminal
LDFPNLPYL2.5.1.18;Glutathione transferase. 55
  • Domain: GST N-terminal
KITQSNAI2.5.1.18;Glutathione transferase. 69
  • Domain: GST N-terminal
CGETEEE2.5.1.18;Glutathione transferase. 87
  • Domain: GST N-terminal
TEEEKIRVDI2.5.1.18;Glutathione transferase. 90
  • Domain: GST C-terminal
IRVDILENQ2.5.1.18;Glutathione transferase. 95
  • Domain: GST C-terminal
FLGKRPWF2.5.1.18;Glutathione transferase. 141
  • Domain: GST C-terminal
CLDAFPNL2.5.1.18;Glutathione transferase. 174
  • Domain: GST C-terminal
FPNLKDF2.5.1.18;Glutathione transferase. 178
  • Domain: GST C-terminal
NLKDFISRFEGL2.5.1.18;Glutathione transferase. 180
  • Domain: GST C-terminal
KISAYMK2.5.1.18;Glutathione transferase. 193
  • Domain: GST C-terminal
SRFLPRP2.5.1.18;Glutathione transferase. 201
  • Domain: GST C-terminal

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MPMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDIL
ENQ
TMDNHMQLGMICYNPEFEKLKPKYLEELPEKLKLYSEFLGKRPWFAGNKITFVDFLVYDVLDLHRIFEPKCLDAFPNLKDFISRFEGLEKISAYMKS
SRFLPRPVFSKMAVWGNK



DME EC Prediction for this protein is: 2.5.1.18
Check another protein