Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
RMLLADQ2.5.1.18;Glutathione transferase. 19
  • Domain: GST N-terminal
LLADQGQSWKEEV2.5.1.18;Glutathione transferase. 21
  • Domain: GST N-terminal
CLYGQLPKF2.5.1.18;Glutathione transferase. 48
  • Domain: GST N-terminal
DGDLTLYQSN2.5.1.18;Glutathione transferase. 58
  • Domain: GST N-terminal
GLYGKDQ2.5.1.18;Glutathione transferase. 78
  • Domain: GST N-terminal
  • Gene: GSTP1
NDGVEDLR2.5.1.18;Glutathione transferase. 94
  • Domain: GST C-terminal
ISFADYNL2.5.1.18;Glutathione transferase. 149
  • Domain: GST C-terminal
FPLLSAYV2.5.1.18;Glutathione transferase. 174
  • Domain: GST C-terminal

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDL
R
CKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYV
NLPINGNGKQ



DME EC Prediction for this protein is: 2.5.1.18
Check another protein