Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
RLQVVLGHL2.3.1.16;Acetyl-CoA C-acyltransferase. 3 -
DVVVVHGRRT2.3.1.16;Acetyl-CoA C-acyltransferase. 37 -
RGGFKDT2.3.1.16;Acetyl-CoA C-acyltransferase. 53 -
MARIAQFLS2.3.1.16;Acetyl-CoA C-acyltransferase. 100 -
NRQCSSGL2.3.1.16;Acetyl-CoA C-acyltransferase. 120
  • Active Site C=Cysteine at location 123 on the protein
  • Active Site Description: Acyl-thioester intermediate (B
CLIPMGIT2.3.1.16;Acetyl-CoA C-acyltransferase. 177 -
PMGITSENVA2.3.1.16;Acetyl-CoA C-acyltransferase. 180 -
FALASQQKAA2.3.1.16;Acetyl-CoA C-acyltransferase. 202 -
PAFKKDG2.3.1;Transferring groups other than amino-acyl groups. 262 -
GSTTAGN2.3.1.16;Acetyl-CoA C-acyltransferase. 268 -
GLPILGV2.3.1.16;Acetyl-CoA C-acyltransferase. 297 -
FEINEAFA2.3.1;Transferring groups other than amino-acyl groups. 342 -
EKVNPLGGA2.3.1.16;Acetyl-CoA C-acyltransferase. 364 -
TLLNELKRRG2.3.1.16;Acetyl-CoA C-acyltransferase. 389 -
SMCIGTGMGAA2.3.1.16;Acetyl-CoA C-acyltransferase. 406
  • Active Site C=Cysteine at location 408 on the protein
  • Active Site Description: Proton acceptor (By similarity
GMGAAAVFE2.3.1.16;Acetyl-CoA C-acyltransferase. 412 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MQRLQVVLGHLRGPADSGWMPQAAPCLSGAPQASAADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMTAVLKDVNLRPEQLGDICVGNVLQPGAGAIM
ARIAQFLS
DIPETVPLSTVNRQCSSGLQAVASIAGGIRNGSYDIGMACGVESMSLADRGNPGNITSRLMEKEKARDCLIPMGITSENVAERFGISREKQD
T
FALASQQKAARAQSKGCFQAEIVPVTTTVHDDKGTKRSITVTQDEGIRPSTTMEGLAKLKPAFKKDGSTTAGNSSQVSDGAAAILLARRSKAEELGLPI
LGV
LRSYAVVGVPPDIMGIGPAYAIPVALQKAGLTVSDVDIFEINEAFASQAAYCVEKLRLPPEKVNPLGGAVALGHPLGCTGARQVITLLNELKRRGKR
AYGVV
SMCIGTGMGAAAVFEYPGN



DME EC Prediction for this protein is: 2.3.1.16
Check another protein