Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
KLAAVAAVLYVIVR3.1.1;Carboxylic ester hydrolases. 18 -
VLYVIVRCLNLKSPTAPPDL3.1.1;Carboxylic ester hydrolases. 25 -
TMVICPGI3.1.1;Carboxylic ester hydrolases. 127 -
ICPGIAN3.1.1;Carboxylic ester hydrolases. 130 -
GYRCAVLNHLGALPNIELTSPRMFTYGCTWEF3.1.1;Carboxylic ester hydrolases. 154 -
VGFSLGGN3.1.1;Carboxylic ester hydrolases. 204
  • Active Site S=Serine at location 207 on the protein
  • Active Site Description: Charge relay system (By simila
VLCCVSVCQGYSALRAQETF3.1.1;Carboxylic ester hydrolases. 227 -
QWDQCRR3.1.1;Carboxylic ester hydrolases. 248 -
YNFLMADNMKKIILSHR3.1.1;Carboxylic ester hydrolases. 256 -
LSRLYTATSLMQIDDN3.1.1;Carboxylic ester hydrolases. 291 -
NSLKEYYE3.1.1;Carboxylic ester hydrolases. 315 -
LHGGHLGFFEG3.1.1;Carboxylic ester hydrolases. 372
  • Active Site H=Histidine at location 376 on the protein
  • Active Site Description: Charge relay system (By simila
PLTWMDK3.1.1;Carboxylic ester hydrolases. 389 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MNAMLETPELPAVFDGVKLAAVAAVLYVIVRCLNLKSPTAPPDLYFQDSGLSRFLLKSCPLLTKEYIPPLIWGKSGHIQTALYGKMGRVRSPHPYGHRKF
ITMSDGATSTFDLFEPLAEHCVGDDI
TMVICPGIANHSEKQYIRTFVDYAQKNGYRCAVLNHLGALPNIELTSPRMFTYGCTWEFGAMVNYIKKTYPLTQ
LVV
VGFSLGGNIVCKYLGETQANQEKVLCCVSVCQGYSALRAQETFMQWDQCRRFYNFLMADNMKKIILSHRQALFGDHVKKPQSLEDTDLSRLYTATSL
MQIDDN
VMRKFHGYNSLKEYYEEESCMRYLHRIYVPLMLVNAADDPLVHESLLTIPKSLSEKRENVMFVLPLHGGHLGFFEGSVLFPEPLTWMDKLVVEY
ANAICQWERNKLQCSDTEQVEADLE



DME EC Prediction for this protein is: 3.1.1
Check another protein