Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
GECKEAL2.7.10.1;Receptor protein-tyrosine kinase. 24
  • Gene: MET
KSEMNVNM2.7.10.1;Receptor protein-tyrosine kinase. 32
  • Domain: Sema
  • Gene: MET
MNVNMKYQLPNFTA2.7.10.1;Receptor protein-tyrosine kinase. 35
  • Domain: Sema
  • Gene: MET
YQLPNFTAET2.7.10.1;Receptor protein-tyrosine kinase. 41
  • Domain: Sema
  • Gene: MET
LHEHHIFLGATNYIYVLNEEDLQKVAE2.7.10.1;Receptor protein-tyrosine kinase. 57
  • Domain: Sema
  • Gene: MET
EYKTGPV2.7.10.1;Receptor protein-tyrosine kinase. 83
  • Domain: Sema
  • Gene: MET
TGPVLEHP2.7.10.1;Receptor protein-tyrosine kinase. 86
  • Domain: Sema
  • Gene: MET
DCSSKAN2.7.10.1;Receptor protein-tyrosine kinase. 100
  • Domain: Sema
  • Gene: MET
KANLSGG2.7.10.1;Receptor protein-tyrosine kinase. 104
  • Domain: Sema
  • Gene: MET
SGGVWKDN2.7.10.1;Receptor protein-tyrosine kinase. 108
  • Domain: Sema
  • Gene: MET
DNINMAL2.7.10.1;Receptor protein-tyrosine kinase. 114
  • Domain: Sema
  • Gene: MET
VDTYYDDQLISCGSV2.7.10.1;Receptor protein-tyrosine kinase. 122
  • Domain: Sema
  • Gene: MET
RGTCQRH2.7.10.1;Receptor protein-tyrosine kinase. 138
  • Domain: Sema
  • Gene: MET
CPDCVVSALG2.7.10.1;Receptor protein-tyrosine kinase. 172
  • Domain: Sema
  • Gene: MET
KDRFINFFVGNTI2.7.10.1;Receptor protein-tyrosine kinase. 189
  • Domain: Sema
  • Gene: MET
NSSYFPDH2.7.10.1;Receptor protein-tyrosine kinase. 202
  • Domain: Sema
  • Gene: MET
LHSISVRR2.7.10.1;Receptor protein-tyrosine kinase. 211
  • Domain: Sema
  • Gene: MET
SVRRLKET2.7.10.1;Receptor protein-tyrosine kinase. 215
  • Domain: Sema
  • Gene: MET
GFMFLTDQSY2.7.10.1;Receptor protein-tyrosine kinase. 225
  • Domain: Sema
  • Gene: MET
FLTDQSYIDVLP2.7.10.1;Receptor protein-tyrosine kinase. 228
  • Domain: Sema
  • Gene: MET
FRDSYPIKY2.7.10.1;Receptor protein-tyrosine kinase. 241
  • Domain: Sema
  • Gene: MET
FIYFLTVQ2.7.10.1;Receptor protein-tyrosine kinase. 258
  • Domain: Sema
  • Gene: MET
FHTRIIRFCS2.7.10.1;Receptor protein-tyrosine kinase. 274
  • Domain: Sema
  • Gene: MET
EMPLECILTEKR2.7.10.1;Receptor protein-tyrosine kinase. 293
  • Domain: Sema
  • Gene: MET
EVFNILQAAYV2.7.10.1;Receptor protein-tyrosine kinase. 312
  • Domain: Sema
  • Gene: MET
KPGAQLA2.7.10.1;Receptor protein-tyrosine kinase. 324
  • Domain: Sema
  • Gene: MET
DDILFGVFAQSKPDSAEP2.7.10.1;Receptor protein-tyrosine kinase. 339
  • Domain: Sema
  • Gene: MET
GVFAQSKPDSAEPM2.7.10.1;Receptor protein-tyrosine kinase. 344
  • Domain: Sema
  • Gene: MET
CAFPIKY2.7.10.1;Receptor protein-tyrosine kinase. 363
  • Domain: Sema
  • Gene: MET
FFNKIVNKNNV2.7.10.1;Receptor protein-tyrosine kinase. 373
  • Domain: Sema
  • Gene: MET
DEYRTEFTTA2.7.10.1;Receptor protein-tyrosine kinase. 414
  • Domain: Sema
  • Gene: MET
DLFMGQF2.7.10.1;Receptor protein-tyrosine kinase. 428
  • Domain: Sema
  • Gene: MET
VLLTSISTF2.7.10.1;Receptor protein-tyrosine kinase. 437
  • Domain: Sema
  • Gene: MET
KGDLTIANLGTSEGRF2.7.10.1;Receptor protein-tyrosine kinase. 447
  • Domain: Sema
  • Gene: MET
LDSHPVS2.7.10.1;Receptor protein-tyrosine kinase. 481
  • Domain: Sema
  • Gene: MET
IPLNGLGC2.7.10.1;Receptor protein-tyrosine kinase. 513
  • Domain: Sema
  • Gene: MET
HFQSCSQCL2.7.10.1;Receptor protein-tyrosine kinase. 522
  • Gene: MET
FVQCGWC2.7.10.1;Receptor protein-tyrosine kinase. 535
  • Gene: MET
KCVRSEEC2.7.10.1;Receptor protein-tyrosine kinase. 544
  • Gene: MET
SGTWTQQICLPAIYKVFP2.7.10.1;Receptor protein-tyrosine kinase. 553
  • Gene: MET
APLEGGT2.7.10.1;Receptor protein-tyrosine kinase. 573
  • Domain: IPT/TIG
  • Gene: MET
CGWDFGF2.7.10.1;Receptor protein-tyrosine kinase. 584
  • Domain: IPT/TIG
  • Gene: MET
NNKFDLKKT2.7.10.1;Receptor protein-tyrosine kinase. 593
  • Domain: IPT/TIG
  • Gene: MET
VLLGNESC2.7.10.1;Receptor protein-tyrosine kinase. 603
  • Domain: IPT/TIG
  • Gene: MET
SCTLTLSEST2.7.10.1;Receptor protein-tyrosine kinase. 609
  • Domain: IPT/TIG
  • Gene: MET
NTLKCTVG2.7.10.1;Receptor protein-tyrosine kinase. 620
  • Domain: IPT/TIG
  • Gene: MET
LKCTVGPA2.7.10.1;Receptor protein-tyrosine kinase. 622
  • Domain: IPT/TIG
  • Gene: MET
HGTTQYSTFSYVDP2.7.10.1;Receptor protein-tyrosine kinase. 644
  • Domain: IPT/TIG
  • Gene: MET
PVITSISP2.7.10.1;Receptor protein-tyrosine kinase. 657
  • Domain: IPT/TIG
  • Gene: MET
GGTLLTL2.7.10.1;Receptor protein-tyrosine kinase. 671
  • Domain: IPT/TIG
  • Gene: MET
TCTLKSVS2.7.10.1;Receptor protein-tyrosine kinase. 696
  • Domain: IPT/TIG
  • Gene: MET
SILECYTP2.7.10.1;Receptor protein-tyrosine kinase. 705
  • Domain: IPT/TIG
  • Gene: MET
LECYTPAQ2.7.10.1;Receptor protein-tyrosine kinase. 707
  • Domain: IPT/TIG
  • Gene: MET
KLKIDLA2.7.10.1;Receptor protein-tyrosine kinase. 723
  • Domain: IPT/TIG
  • Gene: MET
FSYREDP2.7.10.1;Receptor protein-tyrosine kinase. 736
  • Domain: IPT/TIG
  • Gene: MET
YREDPIV2.7.10.1;Receptor protein-tyrosine kinase. 738
  • Domain: IPT/TIG
  • Gene: MET
EDPIVYEIHPTKSFISGGSTITG2.7.10.1;Receptor protein-tyrosine kinase. 740
  • Gene: MET
GKNLNSVS2.7.10.1;Receptor protein-tyrosine kinase. 764
  • Domain: IPT/TIG
  • Gene: MET
TVACQHRS2.7.10.1;Receptor protein-tyrosine kinase. 787
  • Domain: IPT/TIG
  • Gene: MET
SKYFDLIYVH2.7.10.1;Receptor protein-tyrosine kinase. 828
  • Domain: IPT/TIG
  • Gene: MET
YVHNPVF2.7.10.1;Receptor protein-tyrosine kinase. 835
  • Domain: IPT/TIG
  • Gene: MET
FEKPVMIS2.7.10.1;Receptor protein-tyrosine kinase. 844
  • Gene: MET
GNENVLEIKGNDIDPEAVKGEVLKVGNKSCE2.7.10.1;Receptor protein-tyrosine kinase. 853
  • Gene: MET
IDPEAVKGEVLKVGNKSCENIH2.7.10.1;Receptor protein-tyrosine kinase. 865
  • Gene: MET
AVLCTVP2.7.10.1;Receptor protein-tyrosine kinase. 891
  • Gene: MET
DLLKLNS2.7.10.1;Receptor protein-tyrosine kinase. 899
  • Gene: MET
ELNIEWKQA2.7.10.1;Receptor protein-tyrosine kinase. 906
  • Gene: MET
STVLGKVIVQPDQN2.7.10.1;Receptor protein-tyrosine kinase. 917
  • Gene: MET
LGKVIVQPDQNFTGLI2.7.10.1;Receptor protein-tyrosine kinase. 920
  • Gene: MET
PDQNFTGLIAGV2.7.10.1;Receptor protein-tyrosine kinase. 927
  • Gene: MET
FLWLKKRKQ2.7.10.1;Receptor protein-tyrosine kinase. 952
  • Gene: MET
KQIKDLGSELVRYD2.7.10.1;Receptor protein-tyrosine kinase. 959
  • Gene: MET
HTPHLDRLVSARS2.7.10.1;Receptor protein-tyrosine kinase. 976
  • Gene: MET
CRQVQYPLTD2.7.10.1;Receptor protein-tyrosine kinase. 1021
  • Gene: MET
SPILTSGDSD2.7.10.1;Receptor protein-tyrosine kinase. 1032
  • Gene: MET
LVQAVQHVVIGP2.7.10.1;Receptor protein-tyrosine kinase. 1062
  • Gene: MET
HVVIGPSSLIVHFNEVIGRGHFGCVYHGTLLD2.7.10.1;Receptor protein-tyrosine kinase. 1068
  • Gene: MET
IGRGHFGCVYHGTLLDND2.7.10.1;Receptor protein-tyrosine kinase. 1084
  • Domain: Protein kinase
  • Gene: MET
MKDFSHPNV2.7.10.1;Receptor protein-tyrosine kinase. 1131
  • Domain: Protein kinase
EGSPLVVLPYMKHGDLRNFIRNE2.7.10.1;Receptor protein-tyrosine kinase. 1150
  • Domain: Protein kinase
  • Gene: MET
LIGFGLQVA2.7.10;Protein-tyrosine kinases. 1181
  • Domain: Protein kinase
FVHRDLA2.7.10;Protein-tyrosine kinases. 1200
  • Active Site D=Aspartic acid at location 1204 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
RDLAARN2.7.10;Protein-tyrosine kinases. 1203
  • Active Site D=Aspartic acid at location 1204 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
FTVKVADFGLAR2.7.10.1;Receptor protein-tyrosine kinase. 1216
  • Domain: Protein kinase
DKEYYSV2.7.10.1;Receptor protein-tyrosine kinase. 1231
  • Domain: Protein kinase
LPVKWMA2.7.10.1;Receptor protein-tyrosine kinase. 1245
  • Domain: Protein kinase
WMALESL2.7.10;Protein-tyrosine kinases. 1249
  • Domain: Protein kinase
KSDVWSFG2.7.10;Protein-tyrosine kinases. 1263
  • Domain: Protein kinase
QPEYCPD2.7.10.1;Receptor protein-tyrosine kinase. 1304
  • Domain: Protein kinase
EVMLKCWHP2.7.10.1;Receptor protein-tyrosine kinase. 1314
  • Domain: Protein kinase
  • Gene: MET
RPSFSELVS2.7.10.1;Receptor protein-tyrosine kinase. 1327
  • Domain: Protein kinase
  • Gene: MET
ELVSRISAIFS2.7.10.1;Receptor protein-tyrosine kinase. 1332
  • Domain: Protein kinase
  • Gene: MET
CVAPYPSLLSS2.7.10.1;Receptor protein-tyrosine kinase. 1361
  • Gene: MET

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MKAPAVLAPGILVLLFTLVQRSNGECKEALAKSEMNVNMKYQLPNFTAETPIQNVILHEHHIFLGATNYIYVLNEEDLQKVAEYKTGPVLEHPDCFPCQD
CSSKANLSGGVWKDNINMAL
VVDTYYDDQLISCGSVNRGTCQRHVFPHNHTADIQSEVHCIFSPQIEEPSQCPDCVVSALGAKVLSSVKDRFINFFVGNT
INSSYFPDH
PLHSISVRRLKETKDGFMFLTDQSYIDVLPEFRDSYPIKYVHAFESNNFIYFLTVQRETLDAQTFHTRIIRFCSINSGLHSYMEMPLECIL
TEKR
KKRSTKKEVFNILQAAYVSKPGAQLARQIGASLNDDILFGVFAQSKPDSAEPMDRSAMCAFPIKYVNDFFNKIVNKNNVRCLQHFYGPNHEHCFNR
TLLRNSSGCEARR
DEYRTEFTTALQRVDLFMGQFSEVLLTSISTFIKGDLTIANLGTSEGRFMQVVVSRSGPSTPHVNFLLDSHPVSPEVIVEHTLNQNG
YTLVITGKKITK
IPLNGLGCRHFQSCSQCLSAPPFVQCGWCHDKCVRSEECLSGTWTQQICLPAIYKVFPNSAPLEGGTRLTICGWDFGFRRNNKFDLKK
T
RVLLGNESCTLTLSESTMNTLKCTVGPAMNKHFNMSIIISNGHGTTQYSTFSYVDPVITSISPKYGPMAGGTLLTLTGNYLNSGNSRHISIGGKTCTLK
SVS
NSILECYTPAQTISTEFAVKLKIDLANRETSIFSYREDPIVYEIHPTKSFISGGSTITGVGKNLNSVSVPRMVINVHEAGRNFTVACQHRSNSEIIC
CTTPSLQQLNLQLPLKTKAFFMLDGIL
SKYFDLIYVHNPVFKPFEKPVMISMGNENVLEIKGNDIDPEAVKGEVLKVGNKSCENIHLHSEAVLCTVPNDL
LKLNSELNIEWKQA
ISSTVLGKVIVQPDQNFTGLIAGVVSISTALLLLLGFFLWLKKRKQIKDLGSELVRYDARVHTPHLDRLVSARSVSPTTEMVSNES
VDYRATFPEDQFPNSSQNGS
CRQVQYPLTDMSPILTSGDSDISSPLLQNTVHIDLSALNPELVQAVQHVVIGPSSLIVHFNEVIGRGHFGCVYHGTLLDN
D
GKKIHCAVKSLNRITDIGEVSQFLTEGIIMKDFSHPNVLSLLGICLRSEGSPLVVLPYMKHGDLRNFIRNETHNPTVKDLIGFGLQVAKGMKYLASKKF
VHRDLAARN
CMLDEKFTVKVADFGLARDMYDKEYYSVHNKTGAKLPVKWMALESLQTQKFTTKSDVWSFGVLLWELMTRGAPPYPDVNTFDITVYLLQGR
RLL
QPEYCPDPLYEVMLKCWHPKAEMRPSFSELVSRISAIFSTFIGEHYVHVNATYVNVKCVAPYPSLLSSEDNADDEVDTRPASFWETS



DME EC Prediction for this protein is: 2.7.10.1
Check another protein