Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
GKVIKCKAA1.1.1.1;Alcohol dehydrogenase. 5 -
WEAGKPL1.1.1.1;Alcohol dehydrogenase. 16 -
EEVEVAPP1.1.1.1;Alcohol dehydrogenase. 25 -
EVAPPKA1.1.1.1;Alcohol dehydrogenase. 28 -
TSLCHTD1.1.1.1;Alcohol dehydrogenase. 44
  • Metal Site C=Cysteine at location 47 on the protein
  • Metal Site Description: Zinc 1; catalytic (By similari
FPVIVGHEA1.1.1.1;Alcohol dehydrogenase. 63
  • Metal Site H=Histidine at location 69 on the protein
  • Metal Site Description: Zinc 1; catalytic (By similari
GHEAAGIVES1.1.1.1;Alcohol dehydrogenase. 68
  • Metal Site H=Histidine at location 69 on the protein
  • Metal Site Description: Zinc 1; catalytic (By similari
RFTCKGK1.1.1.1;Alcohol dehydrogenase. 135 -
FSQYTVV1.1.1.1;Alcohol dehydrogenase. 152 -
GCGFSTGYG1.1.1.1;Alcohol dehydrogenase. 179
  • Metal Site C=Cysteine at location 180 on the protein
  • Metal Site Description: Zinc 1; catalytic (By similari
AKVTPGS1.1.1;With NAD(+) or NADP(+) as acceptor. 193 -
CAVFGLGGVGLS1.1.1.1;Alcohol dehydrogenase. 201 -
VMGCKAAGA1.1.1.1;Alcohol dehydrogenase. 214 -
MGCKAAGASRII1.1.1.1;Alcohol dehydrogenase. 215 -
AGASRII1.1.1;With NAD(+) or NADP(+) as acceptor. 220 -
LGATDCLNP1.1.1.1;Alcohol dehydrogenase. 241 -
TFFGGWKSV1.1.1.1;Alcohol dehydrogenase. 323
  • Gene: ADH4

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MGTKGKVIKCKAAIAWEAGKPLCIEEVEVAPPKAHEVRIQIIATSLCHTDATVIDSKFEGLAFPVIVGHEAAGIVESIGPGVTNVKPGDKVIPLYAPLCR
KCKFCLSPLTNLCGKISNLKSPASDQQLMEDKTS
RFTCKGKPVYHFFGTSTFSQYTVVSDINLAKIDDDANLERVCLLGCGFSTGYGAAINNAKVTPGST
CAVFGLGGVGLSAVMGCKAAGASRIIGIDINSEKFVKAKALGATDCLNPRDLHKPIQEVIIELTKGGVDFALDCAGGSETMKAALDCTTAGWGSCTFIGV
AAGSKGLTIFPEELIIGRTING
TFFGGWKSVDSIPKLVTDYKNKKFNLDALVTHTLPFDKISEAFDLMNQGKSVRTILIF



DME EC Prediction for this protein is: 1.1.1.1
Check another protein