Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
PRCGVPD3.4.24;Metalloendopeptidases. 90
  • Metal Site C=Cysteine at location 92 on the protein
  • Metal Site Description: Zinc; in inhibited form (By si
YRIVNYT3.4.24;Metalloendopeptidases. 116 -
GEADIMI3.4.24;Metalloendopeptidases. 155
  • Metal Site D=Aspartic acid at location 158 on the protein
  • Metal Site Description: Calcium 2 (By similarity).
VLAHAYAPGPG3.4.24.17;Stromelysin 1. 180
  • Metal Site V=Valine at location 180 on the protein
  • Metal Site Description: Calcium 3; via carbonyl oxygen
  • Gene: MMP3
GTNLFLVA3.4.24;Metalloendopeptidases. 209 -
LFLVAAHE3.4.24;Metalloendopeptidases. 212
  • Metal Site H=Histidine at location 218 on the protein
  • Metal Site Description: Zinc 2; catalytic (By similari
HSLGLFH3.4.24;Metalloendopeptidases. 222
  • Metal Site H=Histidine at location 222 on the protein
  • Metal Site Description: Zinc 2; catalytic (By similari
QDDINGIQ3.4.24;Metalloendopeptidases. 253 -
GIQSLYG3.4.24;Metalloendopeptidases. 258 -
FWRKSLR3.4.24.17;Stromelysin 1. 314
  • Domain: Hemopexin-like
  • Gene: MMP3
IHTLGFP3.4.24;Metalloendopeptidases. 376
  • Domain: Hemopexin-like
DKYWRFDE3.4.24;Metalloendopeptidases. 406
  • Domain: Hemopexin-like
IAEDFPG3.4.24;Metalloendopeptidases. 426
  • Domain: Hemopexin-like

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MKSLPILLLLCVAVCSAYPLDGAARGEDTSMNLVQKYLENYYDLKKDVKQFVRRKDSGPVVKKIREMQKFLGLEVTGKLDSDTLEVMRKPRCGVPDVGHF
RTFPGIPKWRKTHLT
YRIVNYTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYEGEADIMISFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDD
EQWTKDTT
GTNLFLVAAHEIGHSLGLFHSANTEALMYPLYHSLTDLTRFRLSQDDINGIQSLYGPPPDSPETPLVPTEPVPPEPGTPANCDPALSFDAVS
TLRGEILIFKDRH
FWRKSLRKLEPELHLISSFWPSLPSGVDAAYEVTSKDLVFIFKGNQFWAIRGNEVRAGYPRGIHTLGFPPTVRKIDAAISDKEKNKT
YFFVE
DKYWRFDEKRNSMEPGFPKQIAEDFPGIDSKIDAVFEEFGFFYFFTGSSQLEFDPNAKKVTHTLKSNSWLNC



DME EC Prediction for this protein is: 3.4.24.17
Check another protein