Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
AAPSPIIKFPGD3.4.24.24;Gelatinase A. 29
  • Gene: MMP2
PKTDKELAVQYLN3.4.24.24;Gelatinase A. 43
  • Gene: MMP2
CNLFVLKDTLKKMQKFFGLP3.4.24.24;Gelatinase A. 65
  • Gene: MMP2
MQKFFGL3.4.24;Metalloendopeptidases. 77 -
TGDLDQNTIETM3.4.24.24;Gelatinase A. 86
  • Gene: MMP2
YNFFPRK3.4.24.24;Gelatinase A. 110 -
VWSDVTPL3.4.24;Metalloendopeptidases. 150 -
DGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPG3.4.24.24;Gelatinase A. 164
  • Metal Site D=Aspartic acid at location 168 on the protein
  • Metal Site Description: Calcium 2 (By similarity).
  • Gene: MMP2
GEADIMI3.4.24;Metalloendopeptidases. 165
  • Metal Site D=Aspartic acid at location 168 on the protein
  • Metal Site Description: Calcium 2 (By similarity).
DGYPFDG3.4.24;Metalloendopeptidases. 180
  • Metal Site D=Aspartic acid at location 180 on the protein
  • Metal Site Description: Zinc 1; structural (By similar
GLLAHAF3.4.24;Metalloendopeptidases. 189
  • Metal Site L=Leucine at location 190 on the protein
  • Metal Site Description: Calcium 3; via carbonyl oxygen
LAHAFAPG3.4.24;Metalloendopeptidases. 191
  • Metal Site H=Histidine at location 193 on the protein
  • Metal Site Description: Zinc 1 (By similarity).
TLGEGQVVRVKYGNADGEYCKFPF3.4.24.24;Gelatinase A. 214
  • Gene: MMP2
DGFLWCSTT3.4.24.24;Gelatinase A. 254
  • Domain: Fibronectin type-II
  • Gene: MMP2
DGKYGFCPHE3.4.24.24;Gelatinase A. 268
  • Domain: Fibronectin type-II
  • Gene: MMP2
GQPCKFPFRFQGTSY3.4.24.24;Gelatinase A. 288
  • Domain: Fibronectin type-II
  • Gene: MMP2
PFTFLGNK3.4.24.24;Gelatinase A. 352
  • Domain: Fibronectin type-II
  • Gene: MMP2
YDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHS3.4.24.24;Gelatinase A. 381
  • Active Site E=Glutamic acid at location 404 on the protein
  • Active Site Description: By similarity.
  • Metal Site H=Histidine at location 403 on the protein
  • Metal Site Description: Zinc 2; catalytic (By similari
  • Domain: Fibronectin type-II
  • Gene: MMP2
KWGFCPD3.4.24;Metalloendopeptidases. 386
  • Domain: Fibronectin type-II
LFLVAAHE3.4.24;Metalloendopeptidases. 397
  • Metal Site H=Histidine at location 403 on the protein
  • Metal Site Description: Zinc 2; catalytic (By similari
VAAHEFGH3.4.24;Metalloendopeptidases. 400
  • Active Site E=Glutamic acid at location 404 on the protein
  • Active Site Description: By similarity.
  • Metal Site H=Histidine at location 403 on the protein
  • Metal Site Description: Zinc 2; catalytic (By similari
PTLGPVTPE3.4.24.24;Gelatinase A. 459
  • Gene: MMP2
LPEKIDAVYE3.4.24.24;Gelatinase A. 516
  • Metal Site D=Aspartic acid at location 521 on the protein
  • Metal Site Description: Calcium 4; via carbonyl oxygen
  • Domain: Hemopexin-like
  • Gene: MMP2
NKKTYIF3.4.24.24;Gelatinase A. 577
  • Domain: Hemopexin-like
  • Gene: MMP2
LDAVVDLQG3.4.24.24;Gelatinase A. 617
  • Metal Site D=Aspartic acid at location 618 on the protein
  • Metal Site Description: Calcium 4; via carbonyl oxygen
  • Domain: Hemopexin-like
  • Gene: MMP2
YYLKLENQSLKSVK3.4.24.24;Gelatinase A. 636
  • Domain: Hemopexin-like
  • Gene: MMP2

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MEALMARGALTGPLRALCLLGCLLSHAAAAPSPIIKFPGDVAPKTDKELAVQYLNTFYGCPKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKP
RCGNPDVAN
YNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTG
VGGDSHFDDDELW
TLGEGQVVRVKYGNADGEYCKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQPCKFPFRFQGT
SY
DSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKYESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLV
AAHEFGHAMGLEHS
QDPGALMAPIYTYTKNFRLSQDDIKGIQELYGASPDIDLGTGPTPTLGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPR
DKPMGPLLVATFWPE
LPEKIDAVYEAPQEEKAVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDP
GFPKLIADAWNAIPDN
LDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC



DME EC Prediction for this protein is: 3.4.24.24
Check another protein