Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
LENCTVIEG2.7.10.1;Receptor protein-tyrosine kinase. 49 -
FPNLTVI2.7.10.1;Receptor protein-tyrosine kinase. 100 -
YALVIFEM2.7.10.1;Receptor protein-tyrosine kinase. 115 -
IGLYNLRNITRGA2.7.10.1;Receptor protein-tyrosine kinase. 128
  • Gene: IGF1R
NNYIVGNKPPKEC2.7.10.1;Receptor protein-tyrosine kinase. 166
  • Gene: IGF1R
CCHPECLGSC2.7.10.1;Receptor protein-tyrosine kinase. 230 -
PCEGPCPK2.7.10.1;Receptor protein-tyrosine kinase. 323
  • Gene: IGF1R
GPCPKVC2.7.10.1;Receptor protein-tyrosine kinase. 326 -
KTIDSVTSAQ2.7.10.1;Receptor protein-tyrosine kinase. 339 -
VTGYVKIRHSHALVSLSFLK2.7.10.1;Receptor protein-tyrosine kinase. 384
  • Gene: IGF1R
MEEVTGTKGRQ2.7.10.1;Receptor protein-tyrosine kinase. 462 -
RYRPPDYRDLISFTVYYKEAPF2.7.10.1;Receptor protein-tyrosine kinase. 511
  • Domain: Fibronectin type-III
  • Gene: IGF1R
DGQDACG2.7.10.1;Receptor protein-tyrosine kinase. 539
  • Domain: Fibronectin type-III
LKPWTQYA2.7.10.1;Receptor protein-tyrosine kinase. 571
  • Domain: Fibronectin type-III
SASNSSSQL2.7.10.1;Receptor protein-tyrosine kinase. 619
  • Domain: Fibronectin type-III
  • Gene: IGF1R
CACPKTEAE2.7.10.1;Receptor protein-tyrosine kinase. 700
  • Gene: IGF1R
EAEYRKVFENFLHNSIFVPRP2.7.10.1;Receptor protein-tyrosine kinase. 715
  • Gene: IGF1R
ERTVISNL2.7.10.1;Receptor protein-tyrosine kinase. 786
  • Gene: IGF1R
PFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPA2.7.10.1;Receptor protein-tyrosine kinase. 795
  • Gene: IGF1R
PNGLILMYEI2.7.10.1;Receptor protein-tyrosine kinase. 858
  • Domain: Fibronectin type-III
  • Gene: IGF1R
RLGNGVLYASVNPEYFSAA2.7.10.1;Receptor protein-tyrosine kinase. 966
  • Gene: IGF1R
YVPDEWEV2.7.10.1;Receptor protein-tyrosine kinase. 987 -
FGMVYEG2.7.10.1;Receptor protein-tyrosine kinase. 1010
  • Domain: Protein kinase
AKGVVKDE2.7.10.1;Receptor protein-tyrosine kinase. 1018
  • Domain: Protein kinase
  • Gene: IGF1R
AIKTVNE2.7.10.1;Receptor protein-tyrosine kinase. 1031
  • Binding Site K=Lysine at location 1033 on the protein
  • Binding site description: ATP (By similarity).
  • Domain: Protein kinase
RERIEFLNEASVMK2.7.10.1;Receptor protein-tyrosine kinase. 1042
  • Domain: Protein kinase
FNCHHVV2.7.10.1;Receptor protein-tyrosine kinase. 1057
  • Domain: Protein kinase
HVVRLLGV2.7.10.1;Receptor protein-tyrosine kinase. 1061
  • Domain: Protein kinase
GVVSQGQPT2.7.10.1;Receptor protein-tyrosine kinase. 1067
  • Domain: Protein kinase
EIADGMAYL2.7.10.1;Receptor protein-tyrosine kinase. 1118
  • Domain: Protein kinase
DGMAYLNA2.7.10.1;Receptor protein-tyrosine kinase. 1121
  • Domain: Protein kinase
KFVHRDLAARNCMV2.7.10.1;Receptor protein-tyrosine kinase. 1130
  • Active Site D=Aspartic acid at location 1135 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
FVHRDLA2.7.10;Protein-tyrosine kinases. 1131
  • Active Site D=Aspartic acid at location 1135 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
RDLAARN2.7.10;Protein-tyrosine kinases. 1134
  • Active Site D=Aspartic acid at location 1135 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
GLLPVRWM2.7.10.1;Receptor protein-tyrosine kinase. 1172
  • Domain: Protein kinase
PVRWMSPE2.7.10.1;Receptor protein-tyrosine kinase. 1175
  • Domain: Protein kinase
PESLKDG2.7.10.1;Receptor protein-tyrosine kinase. 1181
  • Domain: Protein kinase
GVVLWEI2.7.10.1;Receptor protein-tyrosine kinase. 1199
  • Domain: Protein kinase
QPYQGLSNE2.7.10.1;Receptor protein-tyrosine kinase. 1211
  • Domain: Protein kinase
SNEQVLRFVMEGGLL2.7.10.1;Receptor protein-tyrosine kinase. 1217
  • Domain: Protein kinase
  • Gene: IGF1R
LMRMCWQ2.7.10.1;Receptor protein-tyrosine kinase. 1244
  • Domain: Protein kinase
MCWQYNPKMRP2.7.10.1;Receptor protein-tyrosine kinase. 1247
  • Domain: Protein kinase
GPGVLVLRASFDERQPYAHMNGGR2.7.10.1;Receptor protein-tyrosine kinase. 1330
  • Gene: IGF1R

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MKSGSGGGSPTSLWGLLFLSAALSLWPTSGEICGPGIDIRNDYQQLKRLENCTVIEGYLHILLISKAEDYRSYRFPKLTVITEYLLLFRVAGLESLGDLF
PNLTVI
RGWKLFYNYALVIFEMTNLKDIGLYNLRNITRGAIRIEKNADLCYLSTVDWSLILDAVSNNYIVGNKPPKECGDLCPGTMEEKPMCEKTTINNE
YNYRCWTTNRCQKMCPSTCGKRACTENNE
CCHPECLGSCSAPDNDTACVACRHYYYAGVCVPACPPNTYRFEGWRCVDRDFCANILSAESSDSEGFVIHD
GECMQECPSGFIRNGSQSMYCI
PCEGPCPKVCEEEKKTKTIDSVTSAQMLQGCTIFKGNLLINIRRGNNIASELENFMGLIEVVTGYVKIRHSHALVSLS
FLK
NLRLILGEEQLEGNYSFYVLDNQNLQQLWDWDHRNLTIKAGKMYFAFNPKLCVSEIYRMEEVTGTKGRQSKGDINTRNNGERASCESDVLHFTSTTT
SKNRIIITWH
RYRPPDYRDLISFTVYYKEAPFKNVTEYDGQDACGSNSWNMVDVDLPPNKDVEPGILLHGLKPWTQYAVYVKAVTLTMVENDHIRGAKSE
ILYIRTNASVPSIPLDVL
SASNSSSQLIVKWNPPSLPNGNLSYYIVRWQRQPQDGYLYRHNYCSKDKIPIRKYADGTIDIEEVTENPKTEVCGGEKGPCC
ACPKTEAE
KQAEKEEAEYRKVFENFLHNSIFVPRPERKRRDVMQVANTTMSSRSRNTTAADTYNITDPEELETEYPFFESRVDNKERTVISNLRPFTLYR
IDIHSCNHEAEKLGCSASNFVFARTMPA
EGADDIPGPVTWEPRPENSIFLKWPEPENPNGLILMYEIKYGSQVEDQRECVSRQEYRKYGGAKLNRLNPGN
YTARIQATSLSGNGSWTDPVFFYVQAKTGYENFIHLIIALPVAVLLIVGGLVIMLYVFHRKRNNS
RLGNGVLYASVNPEYFSAADVYVPDEWEVAREKIT
MSRELGQGS
FGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPEMEN
NPVLAPPSLSKMIQMAG
EIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGV
VLWEI
ATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEENKLPEPEELDLEPENM
ESVPLDPSASSSSLPLPDRHSGHKAENGP
GPGVLVLRASFDERQPYAHMNGGRKNERALPLPQSSTC



DME EC Prediction for this protein is: 2.7.10.1
Check another protein