Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
DSRGNPT4.2.1.11;Phosphopyruvate hydratase. 13 -
SRGNPTVE4.2.1.11;Phosphopyruvate hydratase. 14 -
PSGASTG4.2.1.11;Phosphopyruvate hydratase. 36
  • Binding Site S=Serine at location 37 on the protein
  • Binding site description: Substrate.
RYMGKGV4.2.1.11;Phosphopyruvate hydratase. 56 -
GKGVSKAV4.2.1.11;Phosphopyruvate hydratase. 59 -
NKTIAPA4.2.1.11;Phosphopyruvate hydratase. 70 -
DGTENKS4.2.1.11;Phosphopyruvate hydratase. 98 -
FGANAIL4.2.1.11;Phosphopyruvate hydratase. 106 -
GANAILGVS4.2.1.11;Phosphopyruvate hydratase. 107 -
VSLAVCKAGA4.2.1.11;Phosphopyruvate hydratase. 114 -
EKGVPLY4.2.1.11;Phosphopyruvate hydratase. 125 -
GVPLYRH4.2.1.11;Phosphopyruvate hydratase. 127 -
EVILPVPAFNVINGGSHAGNKLAMQEFMI4.2.1.11;Phosphopyruvate hydratase. 142
  • Binding Site H=Histidine at location 158 on the protein
  • Binding site description: Substrate (By similarity).
QEFMILP4.2.1.11;Phosphopyruvate hydratase. 166
  • Binding Site E=Glutamic acid at location 167 on the protein
  • Binding site description: Substrate (By similarity).
EAMRIGAEVYH4.2.1.11;Phosphopyruvate hydratase. 180 -
EVYHNLK4.2.1.11;Phosphopyruvate hydratase. 187 -
KYGKDATNVG4.2.1.11;Phosphopyruvate hydratase. 199 -
NVGDEGG4.2.1.11;Phosphopyruvate hydratase. 206
  • Active Site E=Glutamic acid at location 210 on the protein
  • Active Site Description: Proton donor (By similarity).
GDEGGFAP4.2.1.11;Phosphopyruvate hydratase. 208
  • Active Site E=Glutamic acid at location 210 on the protein
  • Active Site Description: Proton donor (By similarity).
LELLKTAI4.2.1.11;Phosphopyruvate hydratase. 224 -
ELLKTAI4.2.1;Hydro-lyases. 225 -
IGMDVAAS4.2.1.11;Phosphopyruvate hydratase. 242
  • Metal Site D=Aspartic acid at location 245 on the protein
  • Metal Site Description: Magnesium (By similarity).
DVAASEF4.2.1.11;Phosphopyruvate hydratase. 245
  • Metal Site D=Aspartic acid at location 245 on the protein
  • Metal Site Description: Magnesium (By similarity).
GKYDLDFKSPDD4.2.1.11;Phosphopyruvate hydratase. 255 -
PDQLADLY4.2.1.11;Phosphopyruvate hydratase. 273 -
QLADLYK4.2.1.11;Phosphopyruvate hydratase. 275 -
YPVVSIEDPFDQD4.2.1.11;Phosphopyruvate hydratase. 287
  • Metal Site E=Glutamic acid at location 293 on the protein
  • Metal Site Description: Magnesium (By similarity).
  • Binding Site E=Glutamic acid at location 293 on the protein
  • Binding site description: Substrate (By similarity).
VGDDLTV4.2.1.11;Phosphopyruvate hydratase. 316
  • Metal Site D=Aspartic acid at location 318 on the protein
  • Metal Site Description: Magnesium (By similarity).
  • Binding Site D=Aspartic acid at location 318 on the protein
  • Binding site description: Substrate (By similarity).
DDLTVTNP4.2.1.11;Phosphopyruvate hydratase. 318
  • Metal Site D=Aspartic acid at location 318 on the protein
  • Metal Site Description: Magnesium (By similarity).
  • Binding Site D=Aspartic acid at location 318 on the protein
  • Binding site description: Substrate (By similarity).
VTNPKRI4.2.1.11;Phosphopyruvate hydratase. 322 -
LLLKVNQIG4.2.1.11;Phosphopyruvate hydratase. 340
  • Active Site K=Lysine at location 343 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Binding Site K=Lysine at location 343 on the protein
  • Binding site description: Substrate (covalent); in inhib
SHRSGET4.2.1.11;Phosphopyruvate hydratase. 370
  • Binding Site S=Serine at location 373 on the protein
  • Binding site description: Substrate.
RSGETED4.2.1.11;Phosphopyruvate hydratase. 372
  • Binding Site S=Serine at location 373 on the protein
  • Binding site description: Substrate.
FIADLVVGL4.2.1.11;Phosphopyruvate hydratase. 380 -
TGQIKTG4.2.1.11;Phosphopyruvate hydratase. 390
  • Binding Site K=Lysine at location 394 on the protein
  • Binding site description: Substrate (By similarity).
GQIKTGAP4.2.1.11;Phosphopyruvate hydratase. 391
  • Binding Site K=Lysine at location 394 on the protein
  • Binding site description: Substrate (By similarity).
KTGAPCR4.2.1.11;Phosphopyruvate hydratase. 394
  • Binding Site K=Lysine at location 394 on the protein
  • Binding site description: Substrate (By similarity).
RSERLAK4.2.1.11;Phosphopyruvate hydratase. 400 -
KYNQLLRI4.2.1.11;Phosphopyruvate hydratase. 406 -
LRIEEEL4.2.1.11;Phosphopyruvate hydratase. 411 -
KAKFAGR4.2.1.11;Phosphopyruvate hydratase. 420 -
FAGRNFRNP4.2.1.11;Phosphopyruvate hydratase. 423
  • Gene: ENOA

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MSILKIHAREIFDSRGNPTVEVDLFTSKGLFRAAVPSGASTGIYEALELRDNDKTRYMGKGVSKAVEHINKTIAPALVSKKLNVTEQEKIDKLMIEMDGT
ENKS
KFGANAILGVSLAVCKAGAVEKGVPLYRHIADLAGNSEVILPVPAFNVINGGSHAGNKLAMQEFMILPVGAANFREAMRIGAEVYHNLKNVIKEKY
GKDATNVGDEGGFAP
NILENKEGLELLKTAIGKAGYTDKVVIGMDVAASEFFRSGKYDLDFKSPDDPSRYISPDQLADLYKSFIKDYPVVSIEDPFDQDD
WGAWQKFTASAGIQV
VGDDLTVTNPKRIAKAVNEKSCNCLLLKVNQIGSVTESLQACKLAQANGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCR
SERLAKYNQLLRIEEEL
GSKAKFAGRNFRNPLAK



DME EC Prediction for this protein is: 4.2.1.11
Check another protein