Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
SEVRDPLV2.7.10.2;Non-specific protein-tyrosine kinase. 42
  • Gene: LCK
PSHDGDLGFEKGEQLRILEQ2.7.10.2;Non-specific protein-tyrosine kinase. 74
  • Domain: SH3
  • Gene: LCK
AQSLTTGQEG2.7.10.2;Non-specific protein-tyrosine kinase. 100
  • Domain: SH3
  • Gene: LCK
NSLEPEPWFFKNLSRK2.7.10.2;Non-specific protein-tyrosine kinase. 120
  • Domain: SH3
  • Gene: LCK
RKDAERQLL2.7.10.2;Non-specific protein-tyrosine kinase. 134
  • Domain: SH2
FLIRESE2.7.10.2;Non-specific protein-tyrosine kinase. 151
  • Domain: SH2
LSVRDFD2.7.10.2;Non-specific protein-tyrosine kinase. 165
  • Domain: SH2
VKHYKIR2.7.10.2;Non-specific protein-tyrosine kinase. 178
  • Domain: SH2
YISPRITFP2.7.10.2;Non-specific protein-tyrosine kinase. 192
  • Domain: SH2
LVRHYTNASDGLCT2.7.10.2;Non-specific protein-tyrosine kinase. 205
  • Domain: SH2
  • Gene: LCK
TQKPQKPWW2.7.10.2;Non-specific protein-tyrosine kinase. 226
  • Gene: LCK
DEWEVPR2.7.10;Protein-tyrosine kinases. 236 -
LGAGQFGEV2.7.10.2;Non-specific protein-tyrosine kinase. 251
  • Domain: Protein kinase
GQFGEVW2.7.10.2;Non-specific protein-tyrosine kinase. 254
  • Domain: Protein kinase
YNGHTKVA2.7.10.2;Non-specific protein-tyrosine kinase. 264
  • Domain: Protein kinase
  • Gene: LCK
LKQGSMSP2.7.10.2;Non-specific protein-tyrosine kinase. 275
  • Domain: Protein kinase
  • Gene: LCK
LVRLYAVV2.7.10.2;Non-specific protein-tyrosine kinase. 300
  • Domain: Protein kinase
EPIYIITE2.7.10.2;Non-specific protein-tyrosine kinase. 310
  • Domain: Protein kinase
PIYIITE2.7.10;Protein-tyrosine kinases. 311
  • Domain: Protein kinase
GSLVDFLKT2.7.10.2;Non-specific protein-tyrosine kinase. 322
  • Domain: Protein kinase
  • Gene: LCK
DMAAQIA2.7.10.2;Non-specific protein-tyrosine kinase. 343
  • Domain: Protein kinase
AQIAEGMA2.7.10.2;Non-specific protein-tyrosine kinase. 346
  • Domain: Protein kinase
NYIHRDLR2.7.10.2;Non-specific protein-tyrosine kinase. 359
  • Active Site D=Aspartic acid at location 364 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
HRDLRAANILV2.7.10.2;Non-specific protein-tyrosine kinase. 362
  • Active Site D=Aspartic acid at location 364 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
CKIADFGLAR2.7.10.2;Non-specific protein-tyrosine kinase. 378
  • Domain: Protein kinase
ADFGLARLIED2.7.10.2;Non-specific protein-tyrosine kinase. 381
  • Domain: Protein kinase
KFPIKWTAPE2.7.10.2;Non-specific protein-tyrosine kinase. 401
  • Domain: Protein kinase
KWTAPEA2.7.10.2;Non-specific protein-tyrosine kinase. 405
  • Domain: Protein kinase
FTIKSDVWSFG2.7.10.2;Non-specific protein-tyrosine kinase. 417
  • Domain: Protein kinase
IKSDVWSFGILL2.7.10.2;Non-specific protein-tyrosine kinase. 419
  • Domain: Protein kinase
KSDVWSFG2.7.10;Protein-tyrosine kinases. 420
  • Domain: Protein kinase
EIVTHGR2.7.10.2;Non-specific protein-tyrosine kinase. 432
  • Domain: Protein kinase
GRIPYPGM2.7.10.2;Non-specific protein-tyrosine kinase. 437
  • Domain: Protein kinase
PYPGMTN2.7.10.2;Non-specific protein-tyrosine kinase. 440
  • Domain: Protein kinase
NCPEELY2.7.10.2;Non-specific protein-tyrosine kinase. 464
  • Domain: Protein kinase
TATEGQYQ2.7.10.2;Non-specific protein-tyrosine kinase. 499 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MGCGCSSHPEDDWMENIDVCENCHYPIVPLDGKGTLLIRNGSEVRDPLVTYEGSNPPASPLQDNLVIALHSYEPSHDGDLGFEKGEQLRILEQSGEWWKA
QSLTTGQEG
FIPFNFVAKANSLEPEPWFFKNLSRKDAERQLLAPGNTHGSFLIRESESTAGSFSLSVRDFDQNQGEVVKHYKIRNLDNGGFYISPRITFP
GLHELVRHYTNASDGLCTRLSRPCQTQKPQKPWWEDEWEVPRETLKLVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDAFLAEANLMKQLQHQRL
VRLYAVV
TQEPIYIITEYMENGSLVDFLKTPSGIKLTINKLLDMAAQIAEGMAFIEERNYIHRDLRAANILVSDTLSCKIADFGLARLIEDNEYTAREGA
KFPIKWTAPEAINYGTFTIKSDVWSFGILLTEIVTHGRIPYPGMTNPEVIQNLERGYRMVRPDNCPEELYQLMRLCWKERPEDRPTFDYLRSVLEDFFTA
TEGQYQ
PQP



DME EC Prediction for this protein is: 2.7.10.2
Check another protein