Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
EGHLQILLMF2.7.10.1;Receptor protein-tyrosine kinase. 57 -
TDYLLLFRVYGLESL2.7.10.1;Receptor protein-tyrosine kinase. 85 -
FPNLTVI2.7.10.1;Receptor protein-tyrosine kinase. 103 -
LFFNYALV2.7.10.1;Receptor protein-tyrosine kinase. 114 -
YALVIFEM2.7.10.1;Receptor protein-tyrosine kinase. 118 -
NITRGSVRIEKN2.7.10.1;Receptor protein-tyrosine kinase. 138 -
HCQKVCP2.7.10.1;Receptor protein-tyrosine kinase. 214 -
KCIPECPSGYT2.7.10.1;Receptor protein-tyrosine kinase. 310 -
GPCPKVC2.7.10.1;Receptor protein-tyrosine kinase. 333 -
KTIDSVTSAQ2.7.10.1;Receptor protein-tyrosine kinase. 346 -
DGQDACG2.7.10.1;Receptor protein-tyrosine kinase. 546
  • Domain: Fibronectin type-III
LKPWTQYA2.7.10.1;Receptor protein-tyrosine kinase. 583
  • Domain: Fibronectin type-III
RTYGAKS2.7.10.1;Receptor protein-tyrosine kinase. 604
  • Gene: INSR
SQIILKWKPPS2.7.10.1;Receptor protein-tyrosine kinase. 636
  • Domain: Fibronectin type-III
  • Gene: INSR
PNGNITHY2.7.10.1;Receptor protein-tyrosine kinase. 648
  • Domain: Fibronectin type-III
KGLKLPSRTW2.7.10.1;Receptor protein-tyrosine kinase. 676
  • Domain: Fibronectin type-III
  • Gene: INSR
HFTGYRIE2.7.10.1;Receptor protein-tyrosine kinase. 814
  • Domain: Fibronectin type-III
  • Gene: INSR
PNGLIVLYEV2.7.10.1;Receptor protein-tyrosine kinase. 877
  • Domain: Fibronectin type-III
  • Gene: INSR
YVPDEWEV2.7.10.1;Receptor protein-tyrosine kinase. 1011 -
FGMVYEG2.7.10.1;Receptor protein-tyrosine kinase. 1034
  • Domain: Protein kinase
RERIEFLNEASVMK2.7.10.1;Receptor protein-tyrosine kinase. 1066
  • Domain: Protein kinase
HVVRLLGV2.7.10.1;Receptor protein-tyrosine kinase. 1085
  • Domain: Protein kinase
EIADGMAYL2.7.10.1;Receptor protein-tyrosine kinase. 1142
  • Domain: Protein kinase
DGMAYLNA2.7.10.1;Receptor protein-tyrosine kinase. 1145
  • Domain: Protein kinase
KFVHRDLAARNCMV2.7.10.1;Receptor protein-tyrosine kinase. 1154
  • Active Site D=Aspartic acid at location 1159 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
FVHRDLA2.7.10;Protein-tyrosine kinases. 1155
  • Active Site D=Aspartic acid at location 1159 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
RDLAARN2.7.10;Protein-tyrosine kinases. 1158
  • Active Site D=Aspartic acid at location 1159 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
GLLPVRWM2.7.10.1;Receptor protein-tyrosine kinase. 1196
  • Domain: Protein kinase
PESLKDG2.7.10.1;Receptor protein-tyrosine kinase. 1205
  • Domain: Protein kinase
GVVLWEI2.7.10.1;Receptor protein-tyrosine kinase. 1223
  • Domain: Protein kinase
QPYQGLSNE2.7.10.1;Receptor protein-tyrosine kinase. 1235
  • Domain: Protein kinase
LMRMCWQ2.7.10.1;Receptor protein-tyrosine kinase. 1268
  • Domain: Protein kinase

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MATGGRRGAAAAPLLVAVAALLLGAAGHLYPGEVCPGMDIRNNLTRLHELENCSVIEGHLQILLMFKTRPEDFRDLSFPKLIMITDYLLLFRVYGLESLK
DL
FPNLTVIRGSRLFFNYALVIFEMVHLKELGLYNLMNITRGSVRIEKNNELCYLATIDWSRILDSVEDNYIVLNKDDNEECGDICPGTAKGKTNCPATV
INGQFVERCWTHS
HCQKVCPTICKSHGCTAEGLCCHSECLGNCSQPDDPTKCVACRNFYLDGRCVETCPPPYYHFQDWRCVNFSFCQDLHHKCKNSRRQG
CHQYVIHNN
KCIPECPSGYTMNSSNLLCTPCLGPCPKVCHLLEGEKTIDSVTSAQELRGCTVINGSLIINIRGGNNLAAELEANLGLIEEISGYLKIRRS
YALVSLSFFRKLRLIRGETLEIGNYSFYALDNQNLRQLWDWSKHNLTITQGKLFFHYNPKLCLSEIHKMEEVSGTKGRQERNDIALKTNGDQASCENELL
KFSYIRTSFDKILLRWEPYWPPDFRDLLGFMLFYKEAPYQNVTEF
DGQDACGSNSWTVVDIDPPLRSNDPKSQNHPGWLMRGLKPWTQYAIFVKTLVTFS
DER
RTYGAKSDIIYVQTDATNPSVPLDPISVSNSSSQIILKWKPPSDPNGNITHYLVFWERQAEDSELFELDYCLKGLKLPSRTWSPPFESEDSQKHNQS
EYEDSAGECCSCPKTDSQILKELEESSFRKTFEDYLHNVVFVPRKTSSGTGAEDPRPSRKRRSLGDVGNVTVAVPTVAAFPNTSSTSVPTSPEEHRPFEK
VVNKESLVISGLR
HFTGYRIELQACNQDTPEERCSVAAYVSARTMPEAKADDIVGPVTHEIFENNVVHLMWQEPKEPNGLIVLYEVSYRRYGDEELHLCV
SRKHFALERGCRLRGLSPGNYSVRIRATSLAGNGSWTEPTYFYVTDYLDVPSNIAKIIIGPLIFVFLFSVVIGSIYLFLRKRQPDGPLGPLYASSNPEYL
SASDVFPCSV
YVPDEWEVSREKITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNESASLRERIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTL
VVMELMAHGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMAA
EIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYRKGGKGLLPV
RWM
APESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDNCPERVTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPSFPE
VSFFHSEENKAPESEELEMEFEDMENVPLDRSSHCQREEAGGRDGGSSLGFKRSYEEHIPYTHMNGGKKNGRILTLPRSNPS



DME EC Prediction for this protein is: 2.7.10.1
Check another protein