Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
RKGALRQK2.7.11.13;Protein kinase C. 21 -
RFFKQPTFCSHC2.7.11.13;Protein kinase C. 41 -
FIWGIGKQG2.7.11.13;Protein kinase C. 55 -
RCHEFVTF2.7.11.13;Protein kinase C. 76 -
DDPRNKHKF2.7.11.13;Protein kinase C. 95 -
TFCDHCGSLL2.7.11.13;Protein kinase C. 112 -
MNVHRRC2.7.11.13;Protein kinase C. 136 -
DHTERRGR2.7.11.13;Protein kinase C. 153 -
PMDPNGL2.7.11.13;Protein kinase C. 185
  • Metal Site M=Methionine at location 186 on the protein
  • Metal Site Description: Calcium 1; via carbonyl oxygen
  • Domain: C2
VKLKLIPD2.7.11.13;Protein kinase C. 196
  • Domain: C2
LNPVWNE2.7.11.13;Protein kinase C. 219
  • Domain: C2
TSRNDFMG2.7.11.13;Protein kinase C. 250
  • Metal Site S=Serine at location 251 on the protein
  • Metal Site Description: Calcium 3 (By similarity).
  • Domain: C2
KLLNQEEGE2.7.11.13;Protein kinase C. 276 -
EGEYYNVP2.7.11.13;Protein kinase C. 282 -
LLQKFEACNYPLELYERVR2.7.11.13;Protein kinase C. 298
  • Gene: KPCG
VLGKGSFGKV2.7.11.13;Protein kinase C. 356
  • Domain: Protein kinase
GKGSFGKV2.7.11;Protein-serine/threonine kinases. 358
  • Domain: Protein kinase
FGKVMLAE2.7.11.13;Protein kinase C. 362
  • Domain: Protein kinase
EKRVLAL2.7.11.13;Protein kinase C. 399
  • Domain: Protein kinase
DRLYFVME2.7.11.13;Protein kinase C. 428
  • Domain: Protein kinase
FYAAEIA2.7.11;Protein-serine/threonine kinases. 459
  • Domain: Protein kinase
FYAAEIAIGLF2.7.11.13;Protein kinase C. 459
  • Domain: Protein kinase
GIIYRDLK2.7.11;Protein-serine/threonine kinases. 475
  • Active Site D=Aspartic acid at location 480 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
YRDLKLDN2.7.11.13;Protein kinase C. 478
  • Active Site D=Aspartic acid at location 480 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
RDLKLDN2.7.11;Protein-serine/threonine kinases. 479
  • Active Site D=Aspartic acid at location 480 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
IKITDFG2.7.11;Protein-serine/threonine kinases. 494
  • Domain: Protein kinase
DFGMCKE2.7.11.13;Protein kinase C. 498
  • Domain: Protein kinase
TTRTFCGT2.7.11;Protein-serine/threonine kinases. 511
  • Domain: Protein kinase
TFCGTPDYIAPEI2.7.11.13;Protein kinase C. 514
  • Domain: Protein kinase
GTPDYIAPE2.7.11;Protein-serine/threonine kinases. 517
  • Domain: Protein kinase
PYGKSVD2.7.11;Protein-serine/threonine kinases. 531
  • Domain: Protein kinase
VDWWSFGVLLYEML2.7.11.13;Protein kinase C. 536
  • Domain: Protein kinase
GVLLYEM2.7.11;Protein-serine/threonine kinases. 542
  • Domain: Protein kinase
GVLLYEMLAGQ2.7.11.13;Protein kinase C. 542
  • Domain: Protein kinase
GQPPFDGEDE2.7.11.13;Protein kinase C. 551
  • Domain: Protein kinase
EAVAICKG2.7.11.13;Protein kinase C. 581
  • Domain: Protein kinase
CKGFLTK2.7.11.13;Protein kinase C. 586
  • Domain: Protein kinase
KRLGSGPDGEPTIRAHGFFRWIDW2.7.11.13;Protein kinase C. 596
  • Domain: Protein kinase
  • Gene: KPCG
ENFDKFFTR2.7.11.13;Protein kinase C. 641
  • Domain: AGC-kinase C-termina
FQGFTYVNPDFVHPDARSP2.7.11.13;Protein kinase C. 670
  • Domain: AGC-kinase C-termina
  • Gene: KPCG

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MAGLGPGVGDSEGGPRPLFCRKGALRQKVVHEVKSHKFTARFFKQPTFCSHCTDFIWGIGKQGLQCQVCSFVVHRRCHEFVTFECPGAGKGPQTDDPRNK
HKF
RLHSYSSPTFCDHCGSLLYGLVHQGMKCSCCEMNVHRRCVRSVPSLCGVDHTERRGRLQLEIRAPTADEIHVTVGEARNLIPMDPNGLSDPYVKLKL
IPD
PRNLTKQKTRTVKATLNPVWNETFVFNLKPGDVERRLSVEVWDWDRTSRNDFMGAMSFGVSELLKAPVDGWYKLLNQEEGEYYNVPVADADNCSLLQ
KFEACNYPLELYERVR
MGPSSSPIPSPSPSPTDPKRCFFGASPGRLHISDFSFLMVLGKGSFGKVMLAERRGSDELYAIKILKKDVIVQDDDVDCTLVEK
RVLAL
GGRGPGGRPHFLTQLHSTFQTPDRLYFVMEYVTGGDLMYHIQQLGKFKEPHAAFYAAEIAIGLFFLHNQGIIYRDLKLDNVMLDAEGHIKITDFG
MCKE
NVFPGTTTRTFCGTPDYIAPEIIAYQPYGKSVDWWSFGVLLYEMLAGQPPFDGEDEEELFQAIMEQTVTYPKSLSREAVAICKGFLTKHPGKRLGS
GPDGEPTIRAHGFFRWIDW
ERLERLEIPPPFRPRPCGRSGENFDKFFTRAAPALTPPDRLVLASIDQADFQGFTYVNPDFVHPDARSPTSPVPVPVM



DME EC Prediction for this protein is: 2.7.11.13
Check another protein