Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
GAPFSKGQ3.5.3.1;Arginase. 12 -
GGDHSLA3.5.3.1;Arginase. 98
  • Metal Site H=Histidine at location 101 on the protein
  • Metal Site Description: Manganese 1 (By similarity).
AIGSISG3.5.3.1;Arginase. 104 -
VIWVDAH3.5.3.1;Arginase. 120
  • Metal Site D=Aspartic acid at location 124 on the protein
  • Metal Site Description: Manganese 1 (By similarity).
DINTPLTT3.5.3.1;Arginase. 128
  • Metal Site D=Aspartic acid at location 128 on the protein
  • Metal Site Description: Manganese 1 (By similarity).
VYIGLRDVD3.5.3.1;Arginase. 175 -
RPIHLSFD3.5.3.1;Arginase. 225 -
GGLTYREG3.5.3.1;Arginase. 250 -
KTGLLSG3.5.3.1;Arginase. 266
  • Gene: ARGI1
REGNHKP3.5.3.1;Arginase. 308
  • Gene: ARGI1

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGD
HSLAIGSISG
HARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSM
TEVDRLGIGKVMEETLSYLLGRKK
RPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAIT
LACFGLA
REGNHKPIDYLNPPK



DME EC Prediction for this protein is: 3.5.3.1
Check another protein