Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
GFCWAQY3.2.1.1;Alpha-amylase. 11 -
RPWWERYQP3.2.1.1;Alpha-amylase. 71 -
GVRIYVD3.2.1.1;Alpha-amylase. 105 -
PAVPYSGWDFNDGKC3.2.1.1;Alpha-amylase. 142 -
QVRDCRL3.2.1.1;Alpha-amylase. 171
  • Metal Site R=Arginine at location 173 on the protein
  • Metal Site Description: Calcium; via carbonyl oxygen (
GLLDLALEKDYVR3.2.1.1;Alpha-amylase. 179
  • Metal Site D=Aspartic acid at location 182 on the protein
  • Metal Site Description: Calcium (By similarity).
YMNHLID3.2.1.1;Alpha-amylase. 197 -
LDKLHNLN3.2.1.1;Alpha-amylase. 226 -
QEVIDLGGE3.2.1.1;Alpha-amylase. 247
  • Active Site E=Glutamic acid at location 248 on the protein
  • Active Site Description: Proton donor (By similarity).
RVTEFKYGAKLGTVIRKWNGEKM3.2.1.1;Alpha-amylase. 267 -
GEKMSYLKNWGEGWG3.2.1.1;Alpha-amylase. 286 -
DNHDNQR3.2.1.1;Alpha-amylase. 312
  • Active Site D=Aspartic acid at location 315 on the protein
  • Active Site Description: By similarity.
  • Binding Site N=Asparagine at location 313 on the protein
  • Binding site description: Chloride (By similarity).
SILTFWDAR3.2.1.1;Alpha-amylase. 326 -
FMLAHPYG3.2.1.1;Alpha-amylase. 342 -
CEHRWRQ3.2.1.1;Alpha-amylase. 399 -
FRNVVDG3.2.1.1;Alpha-amylase. 412 -
SNQVAFGRG3.2.1.1;Alpha-amylase. 429 -
GFIVFNN3.2.1.1;Alpha-amylase. 440 -
IVFNNDDW3.2.1.1;Alpha-amylase. 442 -
LPAGTYCDV3.2.1.1;Alpha-amylase. 459 -
YCDVISG3.2.1.1;Alpha-amylase. 464 -
AHFSISNS3.2.1.1;Alpha-amylase. 490 -
AEDPFIAIH3.2.1.1;Alpha-amylase. 498 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MKFFLLLFTIGFCWAQYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTR
CNNV
GVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNH
LID
IGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWG
FVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCE
HRWRQ
IRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAED
PFIAIH
AESKL



DME EC Prediction for this protein is: 3.2.1.1
Check another protein