Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
KHSLPDL1.15.1.1;Superoxide dismutase. 25 -
LPDLPYDY1.15.1.1;Superoxide dismutase. 28 -
DYGALEP1.15.1.1;Superoxide dismutase. 34 -
LHHSKHHA1.15.1.1;Superoxide dismutase. 49
  • Metal Site H=Histidine at location 50 on the protein
  • Metal Site Description: Manganese (By similarity).
KHHAAYV1.15.1.1;Superoxide dismutase. 53 -
YVNNLNVTEEKY1.15.1.1;Superoxide dismutase. 58
  • Gene: SODM
EEKYQEAL1.15.1.1;Superoxide dismutase. 66
  • Gene: SODM
EALAKGDVT1.15.1.1;Superoxide dismutase. 71
  • Gene: SODM
KGDVTAQ1.15.1.1;Superoxide dismutase. 75
  • Gene: SODM
ALQPALKF1.15.1.1;Superoxide dismutase. 83 -
GGGHINH1.15.1.1;Superoxide dismutase. 92 -
LSPNGGG1.15.1.1;Superoxide dismutase. 105 -
IKRDFGS1.15.1.1;Superoxide dismutase. 121 -
FGSFDKF1.15.1.1;Superoxide dismutase. 125 -
KFKEKLTA1.15.1.1;Superoxide dismutase. 130
  • Gene: SODM
GSGWGWL1.15.1.1;Superoxide dismutase. 144 -
NQDPLQGTTGL1.15.1.1;Superoxide dismutase. 166
  • Gene: SODM
DVWEHAYY1.15.1.1;Superoxide dismutase. 183
  • Metal Site D=Aspartic acid at location 183 on the protein
  • Metal Site Description: Manganese or iron (By similari
WEHAYYL1.15.1.1;Superoxide dismutase. 185
  • Metal Site H=Histidine at location 187 on the protein
  • Metal Site Description: Manganese or iron (By similari
YKNVRPDY1.15.1.1;Superoxide dismutase. 193 -
KNVRPDYLKAIW1.15.1.1;Superoxide dismutase. 194
  • Gene: SODM

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MLSRAVCGTSRQLAPALGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSI
FWTN
LSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDY
LKAIW
NVINWENVTERYMACKK



DME EC Prediction for this protein is: 1.15.1.1
Check another protein