Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
GILAADES4.1.2.13;Fructose-bisphosphate aldolase. 29 -
ENTEENRR4.1.2.13;Fructose-bisphosphate aldolase. 50
  • Binding Site R=Arginine at location 56 on the protein
  • Binding site description: Substrate (By similarity).
RRFYRQLL4.1.2.13;Fructose-bisphosphate aldolase. 56
  • Binding Site R=Arginine at location 56 on the protein
  • Binding site description: Substrate (By similarity).
GVILFHET4.1.2.13;Fructose-bisphosphate aldolase. 76 -
FHETLYQK4.1.2.13;Fructose-bisphosphate aldolase. 80 -
GIKVDKG4.1.2.13;Fructose-bisphosphate aldolase. 106 -
GETTTQGLDGL4.1.2.13;Fructose-bisphosphate aldolase. 121 -
RCAQYKKDG4.1.2.13;Fructose-bisphosphate aldolase. 134 -
DFAKWRCVLKI4.1.2.13;Fructose-bisphosphate aldolase. 144
  • Binding Site K=Lysine at location 147 on the protein
  • Binding site description: Substrate (By similarity).
ENANVLARYA4.1.2.13;Fructose-bisphosphate aldolase. 166 -
LARYASI4.1.2.13;Fructose-bisphosphate aldolase. 171 -
VPIVEPE4.1.2.13;Fructose-bisphosphate aldolase. 184
  • Active Site E=Glutamic acid at location 188 on the protein
  • Active Site Description: Proton acceptor (By similarity
PDGDHDL4.1.2.13;Fructose-bisphosphate aldolase. 193 -
CQYVTEKVLAA4.1.2.13;Fructose-bisphosphate aldolase. 202 -
VLAAVYKAL4.1.2.13;Fructose-bisphosphate aldolase. 209 -
LEGTLLKPNMVT4.1.2.13;Fructose-bisphosphate aldolase. 224
  • Active Site K=Lysine at location 230 on the protein
  • Active Site Description: Schiff-base intermediate with
EEIAMATVTALRRTVPPAV4.1.2.13;Fructose-bisphosphate aldolase. 247 -
LSGGQSE4.1.2.13;Fructose-bisphosphate aldolase. 271 -
PWALTFS4.1.2.13;Fructose-bisphosphate aldolase. 295 -
FSYGRALQAS4.1.2.13;Fructose-bisphosphate aldolase. 300
  • Binding Site R=Arginine at location 304 on the protein
  • Binding site description: Substrate.
LKAWGGKKENLKAAQ4.1.2.13;Fructose-bisphosphate aldolase. 311 -
KRALANSLACQGKYTPSGQ4.1.2.13;Fructose-bisphosphate aldolase. 330
  • Gene: ALDOA

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MPYQYPALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILFHETLYQKADDGRPFPQVIKS
KGGVV
GIKVDKGVVPLAGTNGETTTQGLDGLSERCAQYKKDGADFAKWRCVLKIGEHTPSALAIMENANVLARYASICQQNGIVPIVEPEILPDGDHDLK
R
CQYVTEKVLAAVYKALSDHHIYLEGTLLKPNMVTPGHACTQKFSHEEIAMATVTALRRTVPPAVTGITFLSGGQSEEEASINLNAINKCPLLKPWALTF
SYGRALQAS
ALKAWGGKKENLKAAQEEYVKRALANSLACQGKYTPSGQAGAAASESLFVSNHAY



DME EC Prediction for this protein is: 4.1.2.13
Check another protein