Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
SNGFGFK2.7.11.1;Non-specific serine/threonine protein kinase. 12
  • Gene: RAF1
CISPTIVQQFGYQRRASDDGK2.7.11.1;Non-specific serine/threonine protein kinase. 27
  • Gene: RAF1
LPNKQRTVV2.7.11.1;Non-specific serine/threonine protein kinase. 62
  • Domain: RBD
GMSLHDCLMK2.7.11.1;Non-specific serine/threonine protein kinase. 75
  • Domain: RBD
  • Gene: RAF1
LKVRGLQPECCAVFRL2.7.11.1;Non-specific serine/threonine protein kinase. 86
  • Domain: RBD
  • Gene: RAF1
RLDWNTDA2.7.11.1;Non-specific serine/threonine protein kinase. 111
  • Domain: RBD
  • Gene: RAF1
VPLTTHNF2.7.11.1;Non-specific serine/threonine protein kinase. 134
  • Metal Site H=Histidine at location 139 on the protein
  • Metal Site Description: Zinc 1 (By similarity).
RKTFLKLAFCDICQKFLLN2.7.11.1;Non-specific serine/threonine protein kinase. 143
  • Metal Site C=Cysteine at location 152 on the protein
  • Metal Site Description: Zinc 2 (By similarity).
  • Gene: RAF1
GFRCQTCGYKFH2.7.11.1;Non-specific serine/threonine protein kinase. 162
  • Metal Site C=Cysteine at location 165 on the protein
  • Metal Site Description: Zinc 1 (By similarity).
FRCQTCGYKFHEHCSTKVPTMCVDWSNIRQLLLFPN2.7.11.1;Non-specific serine/threonine protein kinase. 163
  • Metal Site C=Cysteine at location 165 on the protein
  • Metal Site Description: Zinc 1 (By similarity).
  • Gene: RAF1
LPSLTMRR2.7.11.1;Non-specific serine/threonine protein kinase. 209
  • Gene: RAF1
SSPSSEGSLSQRQRSTSTPNVHMVS2.7.11.1;Non-specific serine/threonine protein kinase. 243
  • Gene: RAF1
HSESASPSA2.7.11.1;Non-specific serine/threonine protein kinase. 284 -
SPNNLSPTGWS2.7.11.1;Non-specific serine/threonine protein kinase. 296
  • Gene: RAF1
TQEKNKIRPRGQRDSSYYWEIEASEV2.7.11.1;Non-specific serine/threonine protein kinase. 324 -
ASEVMLS2.7.11.1;Non-specific serine/threonine protein kinase. 346 -
WHGDVAVK2.7.11.1;Non-specific serine/threonine protein kinase. 368
  • Domain: Protein kinase
NILLFMG2.7.11.1;Non-specific serine/threonine protein kinase. 404
  • Domain: Protein kinase
TQWCEGSSLY2.7.11.1;Non-specific serine/threonine protein kinase. 421
  • Domain: Protein kinase
ARQTAQGMDYLHAK2.7.11.1;Non-specific serine/threonine protein kinase. 449
  • Domain: Protein kinase
KSNNIFLH2.7.11.1;Non-specific serine/threonine protein kinase. 470
  • Domain: Protein kinase
TVKIGDFGLATVK2.7.11.1;Non-specific serine/threonine protein kinase. 481
  • Domain: Protein kinase
RWSGSQQVEQ2.7.11.1;Non-specific serine/threonine protein kinase. 495
  • Domain: Protein kinase
GSVLWMA2.7.11.1;Non-specific serine/threonine protein kinase. 507
  • Domain: Protein kinase
LWMAPEVIRMQD2.7.11.1;Non-specific serine/threonine protein kinase. 510
  • Domain: Protein kinase
WMAPEVI2.7.11;Protein-serine/threonine kinases. 511
  • Domain: Protein kinase
GIVLYELM2.7.11.1;Non-specific serine/threonine protein kinase. 535
  • Domain: Protein kinase
HINNRDQIIFMVGRGYASPDLS2.7.11.1;Non-specific serine/threonine protein kinase. 550
  • Domain: Protein kinase
LYKNCPKA2.7.11.1;Non-specific serine/threonine protein kinase. 573
  • Domain: Protein kinase
ERPLFPQIL2.7.11.1;Non-specific serine/threonine protein kinase. 595
  • Domain: Protein kinase
RSASEPSL2.7.11.1;Non-specific serine/threonine protein kinase. 618 -
EPSLHRAAHTEDI2.7.11.1;Non-specific serine/threonine protein kinase. 622 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MEHIQGAWKTISNGFGFKDAVFDGSSCISPTIVQQFGYQRRASDDGKLTDPSKTSNTIRVFLPNKQRTVVNVRNGMSLHDCLMKALKVRGLQPECCAVFR
L
LHEHKGKKARLDWNTDAASLIGEELQVDFLDHVPLTTHNFARKTFLKLAFCDICQKFLLNGFRCQTCGYKFHEHCSTKVPTMCVDWSNIRQLLLFPNST
IGDSGVPA
LPSLTMRRMRESVSRMPVSSQHRYSTPHAFTFNTSSPSSEGSLSQRQRSTSTPNVHMVSTTLPVDSRMIEDAIRSHSESASPSALSSSPNNL
SPTGWS
QPKTPVPAQRERAPVSGTQEKNKIRPRGQRDSSYYWEIEASEVMLSTRIGSGSFGTVYKGKWHGDVAVKILKVVDPTPEQFQAFRNEVAVLRKT
RHV
NILLFMGYMTKDNLAIVTQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGMDYLHAKNIIHRDMKSNNIFLHEGLTVKIGDFGLATVKSRWSGSQ
QVEQ
PTGSVLWMAPEVIRMQDNNPFSFQSDVYSYGIVLYELMTGELPYSHINNRDQIIFMVGRGYASPDLSKLYKNCPKAMKRLVADCVKKVKEERPLFP
QIL
SSIELLQHSLPKINRSASEPSLHRAAHTEDINACTLTTSPRLPVF



DME EC Prediction for this protein is: 2.7.11.1
Check another protein