Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
SHPWEVIV1.1.1.34;Hydroxymethylglutaryl-CoA reductase (NADPH). 15
  • Gene: HMDH
CPKFEEDVLSSDIIILTITRCIAILYIYFQFQNLRQL1.1.1.34;Hydroxymethylglutaryl-CoA reductase (NADPH). 50
  • Gene: HMDH
EDVLSSD1.1.1;With NAD(+) or NADP(+) as acceptor. 55 -
GSKYILGIAGLFTIFSSF1.1.1.34;Hydroxymethylglutaryl-CoA reductase (NADPH). 87
  • Gene: HMDH
ELTGLNEALPFFLLLIDL1.1.1.34;Hydroxymethylglutaryl-CoA reductase (NADPH). 117
  • Gene: HMDH
NIARGMAILGPT1.1.1.34;Hydroxymethylglutaryl-CoA reductase (NADPH). 156
  • Gene: HMDH
QRVKMIM1.1.1.34;Hydroxymethylglutaryl-CoA reductase (NADPH). 254
  • Gene: HMDH
KVSLGLDE1.1.1.34;Hydroxymethylglutaryl-CoA reductase (NADPH). 288
  • Gene: HMDH
LWQFYLS1.1.1.34;Hydroxymethylglutaryl-CoA reductase (NADPH). 307
  • Gene: HMDH
RKVEVIKPLV1.1.1.34;Hydroxymethylglutaryl-CoA reductase (NADPH). 395
  • Gene: HMDH
EPRPNEECLQIL1.1.1.34;Hydroxymethylglutaryl-CoA reductase (NADPH). 441
  • Gene: HMDH
AKHIPAYKLE1.1.1.34;Hydroxymethylglutaryl-CoA reductase (NADPH). 473
  • Gene: HMDH
LPYRDYNY1.1.1.34;Hydroxymethylglutaryl-CoA reductase (NADPH). 512
  • Gene: HMDH
GACCENVIGYMP1.1.1.34;Hydroxymethylglutaryl-CoA reductase (NADPH). 524 -
VIGYMPIPVG1.1.1.34;Hydroxymethylglutaryl-CoA reductase (NADPH). 530 -
PVGVAGP1.1.1.34;Hydroxymethylglutaryl-CoA reductase (NADPH). 537 -
PMATTEG1.1.1.34;Hydroxymethylglutaryl-CoA reductase (NADPH). 554
  • Active Site E=Glutamic acid at location 559 on the protein
  • Active Site Description: Charge relay system (By simila
LVASTNRG1.1.1.34;Hydroxymethylglutaryl-CoA reductase (NADPH). 562 -
NRGCRAI1.1.1.34;Hydroxymethylglutaryl-CoA reductase (NADPH). 567 -
DGMTRGP1.1.1.34;Hydroxymethylglutaryl-CoA reductase (NADPH). 586 -
FDSTSRF1.1.1.34;Hydroxymethylglutaryl-CoA reductase (NADPH). 622 -
STSRFARL1.1.1.34;Hydroxymethylglutaryl-CoA reductase (NADPH). 624 -
SRFARLQ1.1.1.34;Hydroxymethylglutaryl-CoA reductase (NADPH). 626 -
AGRNLYIR1.1.1.34;Hydroxymethylglutaryl-CoA reductase (NADPH). 639
  • Gene: HMDH
DAMGMNM1.1.1.34;Hydroxymethylglutaryl-CoA reductase (NADPH). 653 -
SGNYCTDKK1.1.1.34;Hydroxymethylglutaryl-CoA reductase (NADPH). 684
  • Active Site K=Lysine at location 691 on the protein
  • Active Site Description: Charge relay system (By simila
NWIEGRGK1.1.1.34;Hydroxymethylglutaryl-CoA reductase (NADPH). 697 -
GRGKSVV1.1.1.34;Hydroxymethylglutaryl-CoA reductase (NADPH). 701 -
GSAMAGS1.1.1.34;Hydroxymethylglutaryl-CoA reductase (NADPH). 739 -
NAHAANI1.1.1.34;Hydroxymethylglutaryl-CoA reductase (NADPH). 750
  • Gene: HMDH
ANIVTAI1.1.1.34;Hydroxymethylglutaryl-CoA reductase (NADPH). 754
  • Gene: HMDH
GQDAAQN1.1.1.34;Hydroxymethylglutaryl-CoA reductase (NADPH). 765
  • Active Site D=Aspartic acid at location 767 on the protein
  • Active Site Description: Charge relay system (By simila
  • Gene: HMDH
AQNVGSSNC1.1.1.34;Hydroxymethylglutaryl-CoA reductase (NADPH). 769
  • Gene: HMDH
SSNCITLM1.1.1.34;Hydroxymethylglutaryl-CoA reductase (NADPH). 774 -
GTVGGGT1.1.1;With NAD(+) or NADP(+) as acceptor. 803 -
PQQACLQMLGVQGA1.1.1.34;Hydroxymethylglutaryl-CoA reductase (NADPH). 813
  • Gene: HMDH
PGENARQLA1.1.1.34;Hydroxymethylglutaryl-CoA reductase (NADPH). 831
  • Gene: HMDH
ELSLMAAL1.1.1.34;Hydroxymethylglutaryl-CoA reductase (NADPH). 850
  • Gene: HMDH
ALAAGHLV1.1.1.34;Hydroxymethylglutaryl-CoA reductase (NADPH). 856 -
HNRSKINLQDL1.1.1.34;Hydroxymethylglutaryl-CoA reductase (NADPH). 869
  • Gene: HMDH

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MLSRLFRMHGLFVASHPWEVIVGTVTLTICMMSMNMFTGNNKICGWNYECPKFEEDVLSSDIIILTITRCIAILYIYFQFQNLRQLGSKYILGIAGLFTI
FSSF
VFSTVVIHFLDKELTGLNEALPFFLLLIDLSRASTLAKFALSSNSQDEVRENIARGMAILGPTFTLDALVECLVIGVGTMSGVRQLEIMCCFGCMS
VLANYFVFMTFFPACVSLVLELSRESREGRPIWQLSHFARVLEEEENKPNPVT
QRVKMIMSLGLVLVHAHSRWIADPSPQNSTADTSKVSLGLDENVSKR
IEPSVS
LWQFYLSKMISMDIEQVITLSLALLLAVKYIFFEQTETESTLSLKNPITSPVVTQKKVPDNCCRREPMLVRNNQKCDSVEEETGINRERKVEVI
KPLV
AETDTPNRATFVVGNSSLLDTSSVLVTQEPEIELPREPRPNEECLQILGNAEKGAKFLSDAEIIQLVNAKHIPAYKLETLMETHERGVSIRRQLLS
KKLSEPSSLQY
LPYRDYNYSLVMGACCENVIGYMPIPVGVAGPLCLDEKEFQVPMATTEGCLVASTNRGCRAIGLGGGASSRVLADGMTRGPVVRLPRAC
DSAEVKAWLETSEGFAVIKEA
FDSTSRFARLQKLHTSIAGRNLYIRFQSRSGDAMGMNMISKGTEKALSKLHEYFPEMQILAVSGNYCTDKKPAAINWIE
GRGKSVV
CEAVIPAKVVREVLKTTTEAMIEVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACGQDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSI
EI
GTVGGGTNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVMAGELSLMAALAAGHLVKSHMIHNRSKINLQDLQGACTKKTA



DME EC Prediction for this protein is: 1.1.1.34
Check another protein