Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
ETQEQDV3.4.24.7;Interstitial collagenase. 25
  • Gene: MMP1
EKLKQMQ3.4.24.7;Interstitial collagenase. 62
  • Gene: MMP1
PRCGVPD3.4.24;Metalloendopeptidases. 90
  • Metal Site C=Cysteine at location 92 on the protein
  • Metal Site Description: Zinc; in inhibited form (By si
WSNVTPL3.4.24;Metalloendopeptidases. 141 -
DNSPFDG3.4.24;Metalloendopeptidases. 170
  • Metal Site D=Aspartic acid at location 170 on the protein
  • Metal Site Description: Zinc 1 (By similarity).
LAHAFQPG3.4.24;Metalloendopeptidases. 181
  • Metal Site H=Histidine at location 183 on the protein
  • Metal Site Description: Zinc 1 (By similarity).
PGPGIGGD3.4.24;Metalloendopeptidases. 187
  • Metal Site G=Glycine at location 190 on the protein
  • Metal Site Description: Calcium 2; via carbonyl oxygen
GHSLGLSHSTD3.4.24;Metalloendopeptidases. 221
  • Metal Site H=Histidine at location 222 on the protein
  • Metal Site Description: Zinc 2; catalytic (By similari
HSTDIGALMYP3.4.24.7;Interstitial collagenase. 228
  • Metal Site H=Histidine at location 228 on the protein
  • Metal Site Description: Zinc 2; catalytic (By similari
  • Gene: MMP1
LTFDAIT3.4.24;Metalloendopeptidases. 282
  • Metal Site D=Aspartic acid at location 285 on the protein
  • Metal Site Description: Calcium 3; via carbonyl oxygen
MFFKDRFYMR3.4.24.7;Interstitial collagenase. 295
  • Domain: Hemopexin-like
  • Gene: MMP1
EVELNFISVFWP3.4.24.7;Interstitial collagenase. 311
  • Domain: Hemopexin-like
  • Gene: MMP1
RDEVRFFKGNKYWAV3.4.24.7;Interstitial collagenase. 337
  • Domain: Hemopexin-like
  • Gene: MMP1
WRYDEYK3.4.24.7;Interstitial collagenase. 398
  • Domain: Hemopexin-like
  • Gene: MMP1
FFHGTRQY3.4.24.7;Interstitial collagenase. 438
  • Domain: Hemopexin-like
  • Gene: MMP1
RQYKFDP3.4.24.7;Interstitial collagenase. 443
  • Domain: Hemopexin-like
  • Gene: MMP1

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MHSFPPLLLLLFWGVVSHSFPATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPVVEKLKQMQEFFGLKVTGKPDAETLKVMKQPRCGVPDVAQF
VLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQL
WSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDED
ERWTNNFREYNLHRVAAHEL
GHSLGLSHSTDIGALMYPSYTFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTPKACDSKLTFDAITTIRGEVMFFKDR
FYMR
TNPFYPEVELNFISVFWPQLPNGLEAAYEFADRDEVRFFKGNKYWAVQGQNVLHGYPKDIYSSFGFPRTVKHIDAALSEENTGKTYFFVANKYWRY
DEYK
RSMDPGYPKMIAHDFPGIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN



DME EC Prediction for this protein is: 3.4.24.7
Check another protein