Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
LGLGLTP3.1.27;Endoribonucleases producing other than 5'-phosphomonoesters. 14 -
PPTLAQD3.1.27;Endoribonucleases producing other than 5'-phosphomonoesters. 20 -
PTLAQDN3.1.27;Endoribonucleases producing other than 5'-phosphomonoesters. 21 -
FLTQHYDAKP3.1.27;Endoribonucleases producing other than 5'-phosphomonoesters. 33
  • Active Site H=Histidine at location 37 on the protein
  • Active Site Description: Proton acceptor (By similarity
MRRRGLTSPCK3.1.27;Endoribonucleases producing other than 5'-phosphomonoesters. 54
  • Gene: ANGI
ENLRISKS3.1.27;Endoribonucleases producing other than 5'-phosphomonoesters. 91
  • Gene: ANGI
FQVTTCK3.1.27;Endoribonucleases producing other than 5'-phosphomonoesters. 100
  • Gene: ANGI
GGSPWPPC3.1.27;Endoribonucleases producing other than 5'-phosphomonoesters. 109
  • Gene: ANGI
YRATAGFR3.1.27;Endoribonucleases producing other than 5'-phosphomonoesters. 118
  • Gene: ANGI
CENGLPVH3.1.27;Endoribonucleases producing other than 5'-phosphomonoesters. 131 -
LPVHLDQSIFR3.1.27;Endoribonucleases producing other than 5'-phosphomonoesters. 135
  • Active Site H=Histidine at location 138 on the protein
  • Active Site Description: Proton donor (By similarity).
  • Gene: ANGI

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MVMGLGVLLLVFVLGLGLTPPTLAQDNSRYTHFLTQHYDAKPQGRDDRYCESIMRRRGLTSPCKDINTFIHGNKRSIKAICENKNGNPHRENLRISKSSF
QVTTCK
LHGGSPWPPCQYRATAGFRNVVVACENGLPVHLDQSIFRRP



DME EC Prediction for this protein is: 3.1.27
Check another protein