Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
GKKSCHT3.4.21;Serine endopeptidases. 133
  • Domain: Transferrin-like
  • Gene: TRFL
YSGAFKCL3.4.21;Serine endopeptidases. 207
  • Metal Site Y=Tyrosine at location 207 on the protein
  • Metal Site Description: Iron 1 (By similarity).
  • Domain: Transferrin-like
  • Gene: TRFL
GDVAFVK3.4.21;Serine endopeptidases. 219
  • Domain: Transferrin-like
  • Gene: TRFL
KADRDQYELLC3.4.21;Serine endopeptidases. 236
  • Domain: Transferrin-like
  • Gene: TRFL
GKKSCHT3.4.21;Serine endopeptidases. 465
  • Domain: Transferrin-like
  • Gene: TRFL
GDVAFVK3.4.21;Serine endopeptidases. 547
  • Domain: Transferrin-like
  • Gene: TRFL

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MRLAVGALLVCAVLGLCLAVPDKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVV
AEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLR
GKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAPCADGTDFPQLCQLCPGCGCST
LNQYFG
YSGAFKCLKDGAGDVAFVKHSTIFENLANKADRDQYELLCLDNTRKPVDEYKDCHLAQVPSHTVVARSMGGKEDLIWELLNQAQEHFGKDKSKE
FQLFSSPHGKDLLFKDSAHGFLKVPPRMDAKMYLGYEYVTAIRNLREGTCPEAPTDECKPVKWCALSHHERLKCDEWSVNSVGKIECVSAETTEDCIAKI
MNGEADAMSLDGGFVYIAGKCGLVPVLAENYNKSDNCEDTPEAGYFAIAVVKKSASDLTWDNLK
GKKSCHTAVGRTAGWNIPMGLLYNKINHCRFDEFFS
EGCAPGSKKDSSLCKLCMGSGLNLCEPNNKEGYYGYTGAFRCLVEK
GDVAFVKHQTVPQNTGGKNPDPWAKNLNEKDYELLCLDGTRKPVEEYANCHLAR
APNHAVVTRKDKEACVHKILRQQQHLFGSNVTDCSGNFCLFRSETKDLLFRDDTVCLAKLHDRNTYEKYLGEEYVKAVGNLRKCSTSSLLEACTFRRP



DME EC Prediction for this protein is: 3.4.21
Check another protein