Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
AYSGGLD6.3.4.5;Argininosuccinate synthase. 10 -
SGGLDTS6.3.4.5;Argininosuccinate synthase. 12 -
DVIAYLANIGQ6.3.4.5;Argininosuccinate synthase. 30
  • Binding Site A=Alanine at location 36 on the protein
  • Binding site description: ATP; via amide nitrogen and ca
  • Gene: ASSY
EDFEEARKKA6.3.4.5;Argininosuccinate synthase. 42
  • Gene: ASSY
KLGAKKVFIED6.3.4.5;Argininosuccinate synthase. 53
  • Gene: ASSY
GTSLARP6.3.4.5;Argininosuccinate synthase. 90
  • Binding Site S=Serine at location 92 on the protein
  • Binding site description: Citrulline (By similarity).
  • Gene: ASSY
TGKGNDQ6.3.4.5;Argininosuccinate synthase. 119
  • Binding Site T=Threonine at location 119 on the protein
  • Binding site description: Aspartate (By similarity).
GNDQVRF6.3.4.5;Argininosuccinate synthase. 122
  • Binding Site N=Asparagine at location 123 on the protein
  • Binding site description: Aspartate (By similarity).
KVIAPWR6.3.4.5;Argininosuccinate synthase. 140 -
GRNDLMEYAKQHGIP6.3.4.5;Argininosuccinate synthase. 156
  • Gene: ASSY
NLMHISYE6.3.4.5;Argininosuccinate synthase. 184
  • Binding Site S=Serine at location 189 on the protein
  • Binding site description: Citrulline (By similarity).
  • Gene: ASSY
GKHGVGR6.3.4.5;Argininosuccinate synthase. 259
  • Gene: ASSY
HGVGRID6.3.4.5;Argininosuccinate synthase. 261
  • Gene: ASSY
GRIDIVENR6.3.4.5;Argininosuccinate synthase. 264
  • Binding Site E=Glutamic acid at location 270 on the protein
  • Binding site description: Citrulline (By similarity).
  • Gene: ASSY
KSRGIYE6.3.4.5;Argininosuccinate synthase. 277
  • Binding Site Y=Tyrosine at location 282 on the protein
  • Binding site description: Citrulline (By similarity).
YETPAGT6.3.4.5;Argininosuccinate synthase. 282
  • Binding Site Y=Tyrosine at location 282 on the protein
  • Binding site description: Citrulline (By similarity).
  • Gene: ASSY
FTMDREVRKIKQ6.3.4.5;Argininosuccinate synthase. 300
  • Gene: ASSY
KGQVYILGRESP6.3.4.5;Argininosuccinate synthase. 355
  • Gene: ASSY
SLYNEELVSM6.3.4.5;Argininosuccinate synthase. 368
  • Gene: ASSY
VQGDYEP6.3.4.5;Argininosuccinate synthase. 379
  • Gene: ASSY

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MSSKGSVVLAYSGGLDTSCILVWLKEQGYDVIAYLANIGQKEDFEEARKKALKLGAKKVFIEDVSREFVEEFIWPAIQSSALYEDRYLLGTSLARPCIAR
KQVEIAQREGAKYVSHGA
TGKGNDQVRFELSCYSLAPQIKVIAPWRMPEFYNRFKGRNDLMEYAKQHGIPIPVTPKNPWSMDENLMHISYEAGILENPKN
QAPPGLYTKTQDPAKAPNTPDILEIEFKKGVPVKVTNVKDGTTHQTSLELFMYLNEVA
GKHGVGRIDIVENRFIGMKSRGIYETPAGTILYHAHLDIEAF
TMDREVRKIKQ
GLGLKFAELVYTGFWHSPECEFVRHCIAKSQERVEGKVQVSVLKGQVYILGRESPLSLYNEELVSMNVQGDYEPTDATGFININSLRLK
EYHRLQSKVTAK



DME EC Prediction for this protein is: 6.3.4.5
Check another protein