Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
KPKVELHVHLDG3.5.4.4;Adenosine deaminase. 9
  • Metal Site H=Histidine at location 15 on the protein
  • Metal Site Description: Zinc.
  • Binding Site D=Aspartic acid at location 19 on the protein
  • Binding site description: Substrate.
  • Gene: ADA
FLAKFDYYMP3.5.4.4;Adenosine deaminase. 61
  • Gene: ADA
KRIAYEFVEMKAK3.5.4.4;Adenosine deaminase. 80
  • Gene: ADA
YVEVRYSPH3.5.4.4;Adenosine deaminase. 97
  • Gene: ADA
QAEGDLTP3.5.4.4;Adenosine deaminase. 119
  • Gene: ADA
RSILCCMRH3.5.4.4;Adenosine deaminase. 149
  • Gene: ADA
SLNTDDP3.5.4.4;Adenosine deaminase. 291
  • Active Site D=Aspartic acid at location 295 on the protein
  • Active Site Description: Potential.
  • Metal Site D=Aspartic acid at location 295 on the protein
  • Metal Site Description: Zinc.
  • Binding Site D=Aspartic acid at location 296 on the protein
  • Binding site description: Substrate.

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MAQTPAFDKPKVELHVHLDGSIKPETILYYGRRRGIALPANTAEGLLNVIGMDKPLTLPDFLAKFDYYMPAIAGCREAIKRIAYEFVEMKAKEGVVYVEV
RYSPH
LLANSKVEPIPWNQAEGDLTPDEVVALVGQGLQEGERDFGVKARSILCCMRHQPNWSPKVVELCKKYQQQTVVAIDLAGDETIPGSSLLPGHVQA
YQEAVKSGIHRTVHAGEVGSAEVVKEAVDILKTERLGHGYHTLEDQALYNRLRQENMHFEICPWSSYLTGAWKPDTEHAVIRLKNDQANY
SLNTDDPLIF
KSTLDTDYQMTKRDMGFTEEEFKRLNINAAKSSFLPEDEKRELLDLLYKAYGMPPSASAGQNL



DME EC Prediction for this protein is: 3.5.4.4
Check another protein