Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
FVVGGPGSGKGTQCEKIV2.7.4.3;Adenylate kinase. 12
  • Gene: KAD1
YGYTHLS2.7.4;Phosphotransferases with a phosphate group as acceptor. 32 -
HLSTGDLLR2.7.4.3;Adenylate kinase. 36
  • Binding Site T=Threonine at location 39 on the protein
  • Binding site description: AMP (By similarity).
TVLDMLRDAM2.7.4.3;Adenylate kinase. 71
  • Gene: KAD1
LIDGYPR2.7.4.3;Adenylate kinase. 91 -
PTLLLYVDAG2.7.4.3;Adenylate kinase. 112
  • Gene: KAD1
TQRLLKR2.7.4;Phosphotransferases with a phosphate group as acceptor. 126 -
DDNEETI2.7.4.3;Adenylate kinase. 140 -
KRGIVRKVNAEG2.7.4.3;Adenylate kinase. 166
  • Gene: KAD1

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MEEKLKKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRSEVSSGSARGKKLSEIMEKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQ
QGEEFERRIGQ
PTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTHLDALK



DME EC Prediction for this protein is: 2.7.4.3
Check another protein