Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
QCAAGCTGP2.7.10.1;Receptor protein-tyrosine kinase. 235 -
TCKDTCPP2.7.10.1;Receptor protein-tyrosine kinase. 259 -
LGLRSLKE2.7.10.1;Receptor protein-tyrosine kinase. 448 -
IDGPHCVK2.7.10.1;Receptor protein-tyrosine kinase. 586 -
TLVWKYADA2.7.10.1;Receptor protein-tyrosine kinase. 605 -
GPGLEGCP2.7.10.1;Receptor protein-tyrosine kinase. 630 -
ELVEPLTPSG2.7.10.1;Receptor protein-tyrosine kinase. 687 -
VKIPVAIK2.7.10.1;Receptor protein-tyrosine kinase. 738
  • Domain: Protein kinase
LREATSPK2.7.10.1;Receptor protein-tyrosine kinase. 747
  • Domain: Protein kinase
LDEAYVMA2.7.10.1;Receptor protein-tyrosine kinase. 760
  • Domain: Protein kinase
RLLGICLTS2.7.10.1;Receptor protein-tyrosine kinase. 776
  • Domain: Protein kinase
EHKDNIGSQ2.7.10.1;Receptor protein-tyrosine kinase. 804
  • Domain: Protein kinase
LLNWCVQIAKGM2.7.10.1;Receptor protein-tyrosine kinase. 814
  • Domain: Protein kinase
VHRDLAARNVLVKTPQHVKITDFGLAK2.7.10.1;Receptor protein-tyrosine kinase. 834
  • Active Site D=Aspartic acid at location 837 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
RDLAARN2.7.10;Protein-tyrosine kinases. 836
  • Active Site D=Aspartic acid at location 837 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
AARNVLV2.7.10;Protein-tyrosine kinases. 839
  • Domain: Protein kinase
GGKVPIKW2.7.10.1;Receptor protein-tyrosine kinase. 873
  • Domain: Protein kinase
YTHQSDVWS2.7.10.1;Receptor protein-tyrosine kinase. 891
  • Domain: Protein kinase
SDVWSYGVT2.7.10;Protein-tyrosine kinases. 895
  • Domain: Protein kinase
YGVTVWE2.7.10.1;Receptor protein-tyrosine kinase. 900
  • Domain: Protein kinase
KPYDGIP2.7.10.1;Receptor protein-tyrosine kinase. 913
  • Domain: Protein kinase
GERLPQP2.7.10;Protein-tyrosine kinases. 930
  • Domain: Protein kinase
GERLPQPPICTI2.7.10.1;Receptor protein-tyrosine kinase. 930
  • Domain: Protein kinase
MVKCWMID2.7.10.1;Receptor protein-tyrosine kinase. 947
  • Domain: Protein kinase
MARDPQR2.7.10.1;Receptor protein-tyrosine kinase. 971
  • Domain: Protein kinase
RYLVIQG2.7.10.1;Receptor protein-tyrosine kinase. 977
  • Domain: Protein kinase
SPSTSRTPLLSSLSATSNNS2.7.10.1;Receptor protein-tyrosine kinase. 1026 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MRPSGTAGAALLALLAALCPASRALEEKKVCQGTSNKLTQLGTFEDHFLSLQRMFNNCEVVLGNLEITYVQRNYDLSFLKTIQEVAGYVLIALNTVERIP
LENLQIIRGNMYYENSYALAVLSNYDANKTGLKELPMRNLQEILHGAVRFSNNPALCNVESIQWRDIVSSDFLSNMSMDFQNHLGSCQKCDPSCPNGSCW
GAGEENCQKLTKIICAQQCSGRCRGKSPSDCCHN
QCAAGCTGPRESDCLVCRKFRDEATCKDTCPPLMLYNPTTYQMDVNPEGKYSFGATCVKKCPRNYV
VTDHGSCVRACGADSYEMEEDGVRKCKKCEGPCRKVCNGIGIGEFKDSLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKE
ITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQFSLAVVSLNITS
LGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQKTKIISNRGENSCK
ATGQVCHALCSPEGCWGPEPRDCVSCRNVSRGRECVDKCNLLEGEPREFVENSECIQCHPECLPQAMNITCTGRGPDNCIQCAHY
IDGPHCVKTCPAGVM
GENN
TLVWKYADAGHVCHLCHPNCTYGCTGPGLEGCPTNGPKIPSIATGMVGALLLLLVVALGIGLFMRRRHIVRKRTLRRLLQERELVEPLTPSGEAPN
QALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEK
VKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLITQLMPFGCLLD
YVR
EHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSY
GVTVWE
LMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRA
LMDEEDMDDVVDADEYLIPQQGFFS
SPSTSRTPLLSSLSATSNNSTVACIDRNGLQSCPIKEDSFLQRYSSDPTGALTEDSIDDTFLPVPEYINQSVPKR
PAGSVQNPVYHNQPLNPAPSRDPHYQDPHSTAVGNPEYLNTVQPTCVNSTFDSPAHWAQKGSHQISLDNPDYQQDFFPKEAKPNGIFKGSTAENAEYLRV
APQSSEFIGA



DME EC Prediction for this protein is: 2.7.10.1
Check another protein