Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
EDFQESN1.16.3.1;Ferroxidase. 251
  • Gene: CERU
WMLSCQNLNHLKAGLQAFF1.16.3.1;Ferroxidase. 334
  • Metal Site C=Cysteine at location 338 on the protein
  • Metal Site Description: Copper 4; type 1 (By similarit
  • Gene: CERU
HLGILGP1.16.3.1;Ferroxidase. 445 -
YYSAVDP1.16.3.1;Ferroxidase. 539 -
TKDIFTGLIGPMKIC1.16.3.1;Ferroxidase. 546
  • Gene: CERU
EDFQESN1.16.3.1;Ferroxidase. 612
  • Gene: CERU
WYLFSAGNE1.16.3.1;Ferroxidase. 644
  • Gene: CERU
YKKVVYR1.16.3.1;Ferroxidase. 779 -
HLGILGP1.16.3.1;Ferroxidase. 804 -
RPYSIHAHGV1.16.3.1;Ferroxidase. 830 -
VHFHGHSFQY1.16.3.1;Ferroxidase. 996
  • Metal Site H=Histidine at location 997 on the protein
  • Metal Site Description: Copper 1; type 2 (By similarit
  • Gene: CERU
HCHVTDH1.16.3.1;Ferroxidase. 1039
  • Metal Site H=Histidine at location 1039 on the protein
  • Metal Site Description: Copper 3; type 3 (By similarit

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MKILILGIFLFLCSTPAWAKEKHYYIGIIETTWDYASDHGEKKLISVDTEHSNIYLQNGPDRIGRLYKKALYLQYTDETFRTTIEKPVWLGFLGPIIKAE
TGDKVYVHLKNLASRPYTFHSHGITYYKEHEGAIYPDNTTDFQRADDKVYPGEQYTYMLLATEEQSPGEGDGNCVTRIYHSHIDAPKDIASGLIGPLIIC
KKDSLDKEKEKHIDREFVVMFSVVDENFSWYLEDNIKTYCSEPEKVDKDN
EDFQESNRMYSVNGYTFGSLPGLSMCAEDRVKWYLFGMGNEVDVHAAFFH
GQALTNKNYRIDTINLFPATLFDAYMVAQNPGE
WMLSCQNLNHLKAGLQAFFQVQECNKSSSKDNIRGKHVRHYYIAAEEIIWNYAPSGIDIFTKENLTA
PGSDSAVFFEQGTTRIGGSYKKLVYREYTDASFTNRKERGPEEE
HLGILGPVIWAEVGDTIRVTFHNKGAYPLSIEPIGVRFNKNNEGTYYSPNYNPQSR
SVPPSASHVAPTETFTYEWTVPKEVGPTNADPVCLAKM
YYSAVDPTKDIFTGLIGPMKICKKGSLHANGRQKDVDKEFYLFPTVFDENESLLLEDNIRMF
TTAPDQVDKED
EDFQESNKMHSMNGFMYGNQPGLTMCKGDSVVWYLFSAGNEADVHGIYFSGNTYLWRGERRDTANLFPQTSLTLHMWPDTEGTFNVECL
TTDHYTGGMKQKYTVNQCRRQSEDSTFYLGERTYYIAAVEVEWDYSPQREWEKELHHLQEQNVSNAFLDKGEFYIGSK
YKKVVYRQYTDSTFRVPVERKA
EEE
HLGILGPQLHADVGDKVKIIFKNMATRPYSIHAHGVQTESSTVTPTLPGETLTYVWKIPERSGAGTEDSACIPWAYYSTVDQVKDLYSGLIGPLIVC
RRPYLKVFNPRRKLEFALLFLVFDENESWYLDDNIKTYSDHPEKVNKDDEEFIESNKMHAINGRMFGNLQGLTMHVGDEVNWYLMGMGNEIDLHT
VHFHG
HSFQY
KHRGVYSSDVFDIFPGTYQTLEMFPRTPGIWLLHCHVTDHIHAGMETTYTVLQNEDTKSG



DME EC Prediction for this protein is: 1.16.3.1
Check another protein