Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
KAVCVLKGD1.15.1.1;Superoxide dismutase. 4
  • Gene: SODC
INFEQKE1.15.1.1;Superoxide dismutase. 19
  • Gene: SODC
NGPVKVWGSI1.15.1.1;Superoxide dismutase. 27
  • Gene: SODC
GLHGFHVH1.15.1.1;Superoxide dismutase. 42
  • Metal Site H=Histidine at location 47 on the protein
  • Metal Site Description: Copper; catalytic (By similari
AGPHFNP1.15.1.1;Superoxide dismutase. 61
  • Metal Site H=Histidine at location 64 on the protein
  • Metal Site Description: Copper; catalytic (By similari
RHVGDLGN1.15.1.1;Superoxide dismutase. 80
  • Metal Site H=Histidine at location 81 on the protein
  • Metal Site Description: Zinc; structural (By similarit
IEDSVISL1.15.1.1;Superoxide dismutase. 100
  • Gene: SODC
GRTLVVH1.15.1.1;Superoxide dismutase. 115 -
HEKADDLG1.15.1.1;Superoxide dismutase. 121
  • Metal Site H=Histidine at location 121 on the protein
  • Metal Site Description: Copper; catalytic (By similari
DDLGKGGN1.15.1.1;Superoxide dismutase. 125 -
GGNEESTKTGNA1.15.1.1;Superoxide dismutase. 130
  • Gene: SODC
TGNAGSRL1.15.1.1;Superoxide dismutase. 138 -
RLACGVIG1.15.1.1;Superoxide dismutase. 144 -
ACGVIGI1.15.1.1;Superoxide dismutase. 146 -
CGVIGIA1.15.1.1;Superoxide dismutase. 147 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSI
EDSVISL
SGDHCIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ



DME EC Prediction for this protein is: 1.15.1.1
Check another protein