Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
NLTHIESRPSRL1.14.16.1;Phenylalanine 4-monooxygenase. 61
  • Domain: ACT
  • Gene: PH4H
KDEYEFFT1.14.16.1;Phenylalanine 4-monooxygenase. 74
  • Domain: ACT
  • Gene: PH4H
ELDADHPGFKD1.14.16;With reduced pteridine as one donor 141 -
GQPIPRVEY1.14.16;With reduced pteridine as one donor 171 -
NHIFPLLEKYCGF1.14.16.1;Phenylalanine 4-monooxygenase. 207
  • Gene: PH4H
PQLEDVS1.14.16;With reduced pteridine as one donor 225 -
RPVAGLLS1.14.16;With reduced pteridine as one donor 243 -
GLAFRVFH1.14.16;With reduced pteridine as one donor 257 -
RVFHCTQY1.14.16;With reduced pteridine as one donor 261 -
YTPEPDICHELLGHVPLF1.14.16.1;Phenylalanine 4-monooxygenase. 277
  • Metal Site H=Histidine at location 285 on the protein
  • Metal Site Description: Iron (By similarity).
  • Gene: PH4H
HELLGHVP1.14.16;With reduced pteridine as one donor 285
  • Metal Site H=Histidine at location 285 on the protein
  • Metal Site Description: Iron (By similarity).
FSQEIGLAS1.14.16;With reduced pteridine as one donor 302 -
IGLASLG1.14.16;With reduced pteridine as one donor 306 -
YWFTVEFGLC1.14.16;With reduced pteridine as one donor 325
  • Metal Site E=Glutamic acid at location 330 on the protein
  • Metal Site Description: Iron (By similarity).
EFGLCKQ1.14.16;With reduced pteridine as one donor 330
  • Metal Site E=Glutamic acid at location 330 on the protein
  • Metal Site Description: Iron (By similarity).
KAYGAGLLSSFGELQY1.14.16.1;Phenylalanine 4-monooxygenase. 341
  • Gene: PH4H
GAGLLSS1.14.16;With reduced pteridine as one donor 344 -
KPKLLPLELEKTA1.14.16.1;Phenylalanine 4-monooxygenase. 361
  • Gene: PH4H
YYVAESF1.14.16;With reduced pteridine as one donor 386 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MSTAVLENPGLGRKLSDFGQETSYIEDNCNQNGAISLIFSLKEEVGALAKVLRLFEENDVNLTHIESRPSRLKKDEYEFFTHLDKRSLPALTNIIKILRH
DIGATVHELSRDKKKDTVPWFPRTIQELDRFANQILSYGA
ELDADHPGFKDPVYRARRKQFADIAYNYRHGQPIPRVEYMEEEKKTWGTVFKTLKSLYKT
HACYEY
NHIFPLLEKYCGFHEDNIPQLEDVSQFLQTCTGFRLRPVAGLLSSRDFLGGLAFRVFHCTQYIRHGSKPMYTPEPDICHELLGHVPLFSDRSFA
Q
FSQEIGLASLGAPDEYIEKLATIYWFTVEFGLCKQGDSIKAYGAGLLSSFGELQYCLSEKPKLLPLELEKTAIQNYTVTEFQPLYYVAESFNDAKEKVR
NFAATIPRPFSVRYDPYTQRIEVLDNTQQLKILADSINSEIGILCSALQKIK



DME EC Prediction for this protein is: 1.14.16.1
Check another protein