Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
TKIFINNEW1.2.1;With NAD(+) or NADP(+) as acceptor. 21 -
GDKEDVD1.2.1;With NAD(+) or NADP(+) as acceptor. 55 -
DVDKAVKAA1.2.1;With NAD(+) or NADP(+) as acceptor. 59 -
AARQAFQIGSPWRTMDASERGRLL1.2.1;With NAD(+) or NADP(+) as acceptor. 66 -
AARQAFQIGSPWRTMDASERGRLLYKLADL1.2.1.36;Retinal dehydrogenase. 66
  • Gene: AL1A1
LADLIERD1.2.1;With NAD(+) or NADP(+) as acceptor. 92 -
RHEPIGV1.2.1;With NAD(+) or NADP(+) as acceptor. 156 -
QIIPWNFP1.2.1;With NAD(+) or NADP(+) as acceptor. 165 -
KPAEQTPL1.2.1;With NAD(+) or NADP(+) as acceptor. 193 -
LIKEAGFPPGVVNIVPGYGPTAGAAISSHMDIDKVAFTGS1.2.1.36;Retinal dehydrogenase. 208
  • Gene: AL1A1
EAGFPPGV1.2.1;With NAD(+) or NADP(+) as acceptor. 211 -
GVVNIVPG1.2.1;With NAD(+) or NADP(+) as acceptor. 217 -
GYGPTAG1.2.1;With NAD(+) or NADP(+) as acceptor. 224 -
GPTAGAAI1.2.1;With NAD(+) or NADP(+) as acceptor. 226 -
VTLELGG1.2.1;With NAD(+) or NADP(+) as acceptor. 266
  • Active Site E=Glutamic acid at location 269 on the protein
  • Active Site Description: Proton acceptor (By similarity
TLELGGK1.2.1;With NAD(+) or NADP(+) as acceptor. 267
  • Active Site E=Glutamic acid at location 269 on the protein
  • Active Site Description: Proton acceptor (By similarity
FVEESIY1.2.1;With NAD(+) or NADP(+) as acceptor. 310 -
RSVERAK1.2.1;With NAD(+) or NADP(+) as acceptor. 322 -
QGPQIDKEQ1.2.1;With NAD(+) or NADP(+) as acceptor. 342 -
EGAKLECGG1.2.1;With NAD(+) or NADP(+) as acceptor. 364 -
MRIAKEEIFGPV1.2.1;With NAD(+) or NADP(+) as acceptor. 394 -
VIKRANNT1.2.1;With NAD(+) or NADP(+) as acceptor. 417 -
AGVFTKD1.2.1;With NAD(+) or NADP(+) as acceptor. 430 -
ALQAGTVW1.2.1;With NAD(+) or NADP(+) as acceptor. 446 -
PFGGFKMSGNGRE1.2.1;With NAD(+) or NADP(+) as acceptor. 465 -
GNGRELGE1.2.1;With NAD(+) or NADP(+) as acceptor. 473 -
YTEVKTVT1.2.1;With NAD(+) or NADP(+) as acceptor. 486 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MSSSGTPDLPVLLTDLKIQYTKIFINNEWHDSVSGKKFPVFNPATEEELCQVEEGDKEDVDKAVKAARQAFQIGSPWRTMDASERGRLLYKLADLIERDR
LLLATMESMNGGKLYSNAYLNDLAGCIKTLRYCAGWADKIQGRTIPIDGNFFTYT
RHEPIGVCGQIIPWNFPLVMLIWKIGPALSCGNTVVVKPAEQTPL
TALHVASLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDIDKVAFTGSTEVGKLIKEAAGKSNLKRVTLELGGKSPCIVLADADLDNAVEFAHHGVFYHQG
QCCIAASRI
FVEESIYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQYDKILDLIESGKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRIAKEE
IFGPV
QQIMKFKSLDDVIKRANNTFYGLSAGVFTKDIDKAITISSALQAGTVWVNCYGVVSAQCPFGGFKMSGNGRELGEYGFHEYTEVKTVTVKISQKN
S



DME EC Prediction for this protein is: 1.2.1.36
Check another protein