Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
TAGKVIKC1.1.1.1;Alcohol dehydrogenase. 3 -
GKVIKCKAA1.1.1.1;Alcohol dehydrogenase. 5 -
EVAPPKA1.1.1.1;Alcohol dehydrogenase. 28 -
EVRIKMV1.1.1.1;Alcohol dehydrogenase. 36 -
GICRTDDH1.1.1.1;Alcohol dehydrogenase. 45
  • Metal Site C=Cysteine at location 47 on the protein
  • Metal Site Description: Zinc 1; catalytic (By similari
PVILGHE1.1.1;With NAD(+) or NADP(+) as acceptor. 63
  • Metal Site H=Histidine at location 68 on the protein
  • Metal Site Description: Zinc 1; catalytic (By similari
ILGHEAAG1.1.1;With NAD(+) or NADP(+) as acceptor. 65
  • Metal Site H=Histidine at location 68 on the protein
  • Metal Site Description: Zinc 1; catalytic (By similari
GHEAAGIVES1.1.1.1;Alcohol dehydrogenase. 67
  • Metal Site H=Histidine at location 68 on the protein
  • Metal Site Description: Zinc 1; catalytic (By similari
GIVESVG1.1.1.1;Alcohol dehydrogenase. 72 -
ESVGEGVT1.1.1.1;Alcohol dehydrogenase. 75 -
PGDKVIPLF1.1.1;With NAD(+) or NADP(+) as acceptor. 86 -
PQCGKCR1.1.1.1;Alcohol dehydrogenase. 96
  • Metal Site C=Cysteine at location 98 on the protein
  • Metal Site Description: Zinc 2 (By similarity).
CKNPESN1.1.1.1;Alcohol dehydrogenase. 104
  • Metal Site C=Cysteine at location 104 on the protein
  • Metal Site Description: Zinc 2 (By similarity).
GKPIHHFLG1.1.1.1;Alcohol dehydrogenase. 135 -
FSQYTVV1.1.1.1;Alcohol dehydrogenase. 147 -
PLEKVCL1.1.1.1;Alcohol dehydrogenase. 166 -
CLIGCGF1.1.1;With NAD(+) or NADP(+) as acceptor. 171
  • Metal Site C=Cysteine at location 171 on the protein
  • Metal Site Description: Zinc 1; catalytic (By similari
GCGFSTGYG1.1.1.1;Alcohol dehydrogenase. 174
  • Metal Site C=Cysteine at location 175 on the protein
  • Metal Site Description: Zinc 1; catalytic (By similari
AKVTPGS1.1.1;With NAD(+) or NADP(+) as acceptor. 188 -
CAVFGLGGVGLS1.1.1.1;Alcohol dehydrogenase. 196 -
VMGCKAAGA1.1.1.1;Alcohol dehydrogenase. 209 -
DINKDKF1.1.1.1;Alcohol dehydrogenase. 224
  • Binding Site D=Aspartic acid at location 224 on the protein
  • Binding site description: NAD (By similarity).
NKDKFAKAK1.1.1.1;Alcohol dehydrogenase. 226
  • Binding Site K=Lysine at location 229 on the protein
  • Binding site description: NAD (By similarity).
GATECINP1.1.1.1;Alcohol dehydrogenase. 237 -
CINPQDY1.1.1.1;Alcohol dehydrogenase. 241 -
KPIQEVL1.1.1.1;Alcohol dehydrogenase. 249 -
EMTDGGV1.1.1.1;Alcohol dehydrogenase. 257 -
SVIVGVPP1.1.1.1;Alcohol dehydrogenase. 290 -
GRTWKGA1.1.1.1;Alcohol dehydrogenase. 312 -
DFMAKKF1.1.1.1;Alcohol dehydrogenase. 335 -
LITHVLPFEKIN1.1.1.1;Alcohol dehydrogenase. 346 -
KINEGFDLL1.1.1.1;Alcohol dehydrogenase. 355 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MSTAGKVIKCKAAVLWEVKKPFSIEDVEVAPPKAYEVRIKMVAVGICRTDDHVVSGNLVTPLPVILGHEAAGIVESVGEGVTTVKPGDKVIPLFTPQCGK
CR
VCKNPESNYCLKNDLGNPRGTLQDGTRRFTCRGKPIHHFLGTSTFSQYTVVDENAVAKIDAASPLEKVCLIGCGFSTGYGSAVNVAKVTPGSTCAVFG
LGGVGLS
AVMGCKAAGAARIIAVDINKDKFAKAKELGATECINPQDYKKPIQEVLKEMTDGGVDFSFEVIGRLDTMMASLLCCHEACGTSVIVGVPPASQ
NLSINPMLLLT
GRTWKGAVYGGFKSKEGIPKLVADFMAKKFSLDALITHVLPFEKINEGFDLLHSGKSIRTVLTF



DME EC Prediction for this protein is: 1.1.1.1
Check another protein