Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
RGGPEHR4.6.1.1;Adenylate cyclase. 23
  • Gene: ADCY5
GDDPLAGGFGFSFRS4.6.1.1;Adenylate cyclase. 85
  • Gene: ADCY5
LERLYQRYF4.6.1.1;Adenylate cyclase. 226 -
LAVLAAAVGVIL4.6.1.1;Adenylate cyclase. 271
  • Gene: ADCY5
MAVLCNRAAFHQDHMGLACYALIAVVLAVQVVGLLLPQPR4.6.1.1;Adenylate cyclase. 284
  • Gene: ADCY5
RMRAAVLSG4.6.1.1;Adenylate cyclase. 346 -
CTHYPAEVSQRQAFQETR4.6.1.1;Adenylate cyclase. 395 -
QQERLLLS4.6.1.1;Adenylate cyclase. 427 -
ERLLLSVLP4.6.1.1;Adenylate cyclase. 429 -
FHKIYIQ4.6.1.1;Adenylate cyclase. 457 -
LASQCTAQELV4.6.1.1;Adenylate cyclase. 481
  • Domain: Guanylate cyclase
RIKILGDCYYC4.6.1.1;Adenylate cyclase. 512
  • Metal Site D=Aspartic acid at location 518 on the protein
  • Metal Site Description: Magnesium 1 (By similarity).
  • Domain: Guanylate cyclase
DHAHCCVEMG4.6.1.1;Adenylate cyclase. 532
  • Domain: Guanylate cyclase
MRVGIHSG4.6.1.1;Adenylate cyclase. 561
  • Domain: Guanylate cyclase
CGVLGLRKWQFDVWS4.6.1.1;Adenylate cyclase. 572
  • Domain: Guanylate cyclase
DVTLANHME4.6.1.1;Adenylate cyclase. 588
  • Domain: Guanylate cyclase
AGRIHIT4.6.1.1;Adenylate cyclase. 601 -
LNGDYEVEPG4.6.1.1;Adenylate cyclase. 614 -
IETFLIL4.6.1.1;Adenylate cyclase. 637 -
QKRKEEKAM4.6.1.1;Adenylate cyclase. 647 -
NPEDEVDEFL4.6.1.1;Adenylate cyclase. 711 -
RAIDARSID4.6.1.1;Adenylate cyclase. 722 -
DLEKKYS4.6.1.1;Adenylate cyclase. 748 -
RFGAYVACA4.6.1.1;Adenylate cyclase. 760 -
VQITIVPHS4.6.1.1;Adenylate cyclase. 778
  • Gene: ADCY5
FMLSFYL4.6.1.1;Adenylate cyclase. 788
  • Gene: ADCY5
LSRKIVRSK4.6.1.1;Adenylate cyclase. 823
  • Gene: ADCY5
NSTLVGVFTITLVFL4.6.1.1;Adenylate cyclase. 833
  • Gene: ADCY5
SVLLSLLA4.6.1.1;Adenylate cyclase. 913 -
VTLFDNADLLVTANAID4.6.1.1;Adenylate cyclase. 952
  • Gene: ADCY5
RLDFLWK4.6.1.1;Adenylate cyclase. 1013 -
EKEEMEELQAYNRRLLHNILPKDVAAHFLARERRNDEL4.6.1.1;Adenylate cyclase. 1025 -
ECLRLLNEII4.6.1.1;Adenylate cyclase. 1095
  • Domain: Guanylate cyclase
LNEIIADFDEIISE4.6.1.1;Adenylate cyclase. 1100
  • Domain: Guanylate cyclase
EKIKTIG4.6.1.1;Adenylate cyclase. 1120
  • Domain: Guanylate cyclase
TYMAASGLN4.6.1.1;Adenylate cyclase. 1128
  • Domain: Guanylate cyclase
AGVIGARKP4.6.1.1;Adenylate cyclase. 1186
  • Domain: Guanylate cyclase
TVNVASR4.6.1.1;Adenylate cyclase. 1202
  • Domain: Guanylate cyclase
SRMDSTGV4.6.1.1;Adenylate cyclase. 1207
  • Domain: Guanylate cyclase
YQLECRGVVKVKGKGEM4.6.1.1;Adenylate cyclase. 1233 -
TYFLNGGP4.6.1.1;Adenylate cyclase. 1251 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MSGSKSVSPPGYAAQKTAAPAPRGGPEHRSAWGEADSRANGYPHAPGGSARGSTKKPGGAVTPQQQQRLASRWRSDDDDDPPLSGDDPLAGGFGFSFRSK
SAWQERGGDDCGRGSRRQRRGAASGGSTRAPPAGGGGGSAAAAASAGGTEVRPRSVEVGLEERRGKGRAADELEAGAVEGGEGSGDGGSSADSGSGAGPG
AVLSLGACCLALLQIFRSKKFPSDK
LERLYQRYFFRLNQSSLTMLMAVLVLVCLVMLAFHAARPPLQLPYLAVLAAAVGVILIMAVLCNRAAFHQDHMGL
ACYALIAVVLAVQVVGLLLPQPR
SASEGIWWTVFFIYTIYTLLPVRMRAAVLSGVLLSALHLAIALRTNAQDQFLLKQLVSNVLIFSCTNIVGVCTHYPA
EVSQRQAFQETR
ECIQARLHSQRENQQQERLLLSVLPRHVAMEMKADINAKQEDMMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFAR
FDKLAAENHCL
RIKILGDCYYCVSGLPEARADHAHCCVEMGMDMIEAISLVREVTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGGK
AGRIHITKATLNYLNGDYEVEPGCGGERNAYLKEHSIETFLILRCTQKRKEEKAMIAKMNRQRTNSIGHNPPHWGAERPFYNHLGGNQVSKEMKRMGFED
PKDKNAQESA
NPEDEVDEFLGRAIDARSIDRLRSEHVRKFLLTFREPDLEKKYSKQVDDRFGAYVACASLVFLFICFVQITIVPHSIFMLSFYLTCSLLL
TLVVFVSVIYSCVKLFPSPLQT
LSRKIVRSKMNSTLVGVFTITLVFLAAFVNMFTCNSRDLLGCLAQEHNISASQVNACHVAESAVNYSLGDEQGFCGSP
WPNCNFPEYFTY
SVLLSLLACSVFLQISCIGKLVLMLAIELIYVLIVEVPGVTLFDNADLLVTANAIDFFNNGTSQCPEHATKVALKVVTPIIISVFVLA
LYLHAQQVESTA
RLDFLWKLQATEEKEEMEELQAYNRRLLHNILPKDVAAHFLARERRNDELYYQSCECVAVMFASIANFSEFYVELEANNEGVECLRLL
NEIIADFDEIISE
DRFRQLEKIKTIGSTYMAASGLNDSTYDKVGKTHIKALADFAMKLMDQMKYINEHSFNNFQMKIGLNIGPVVAGVIGARKPQYDIWG
N
TVNVASRMDSTGVPDRIQVTTDMYQVLAANTYQLECRGVVKVKGKGEMMTYFLNGGPPLS



DME EC Prediction for this protein is: 4.6.1.1
Check another protein