Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
GELGDGAFGKVYKA2.7.11.1;Non-specific serine/threonine protein kinase. 40
  • Domain: Protein kinase
IIHRDLKA2.7.11;Protein-serine/threonine kinases. 153
  • Active Site D=Aspartic acid at location 157 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
FIGTPYWMAPEV2.7.11.1;Non-specific serine/threonine protein kinase. 192
  • Domain: Protein kinase
GTPYWMAPE2.7.11;Protein-serine/threonine kinases. 194
  • Domain: Protein kinase
GTPYWMAPEVV2.7.11.1;Non-specific serine/threonine protein kinase. 194
  • Domain: Protein kinase
KADIWSLGIT2.7.11.1;Non-specific serine/threonine protein kinase. 217
  • Domain: Protein kinase
IEPPHHELNPMRVLLKIAKS2.7.11.1;Non-specific serine/threonine protein kinase. 233
  • Domain: Protein kinase
KQQLKDQYF2.7.11.1;Non-specific serine/threonine protein kinase. 759 -
EQMQRYNQR2.7.11.1;Non-specific serine/threonine protein kinase. 782 -
ARLPKIQRS2.7.11.1;Non-specific serine/threonine protein kinase. 804 -
QLQNEKC2.7.11.1;Non-specific serine/threonine protein kinase. 882 -
LLVEHETQKLK2.7.11.1;Non-specific serine/threonine protein kinase. 890 -
KLRPRKK2.7.11.1;Non-specific serine/threonine protein kinase. 916 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MAFANFRRILRLSTFEKRKSREYEHVRRDLDPNEVWEIVGELGDGAFGKVYKAKNKETGALAAAKVIETKSEEELEDYIVEIEILATCDHPYIVKLLGAY
YHDGKLWIMIEFCPGGAVDAIMLELDRGLTEPQIQVVCRQMLEALNFLHSKR
IIHRDLKAGNVLMTLEGDIRLADFGVSAKNLKTLQKRDSFIGTPYWMA
PEVV
MCETMKDTPYDYKADIWSLGITLIEMAQIEPPHHELNPMRVLLKIAKSDPPTLLTPSKWSVEFRDFLKIALDKNPETRPSAAQLLEHPFVSSITSN
KALRELVAEAKAEVMEEIEDGRDEGEEEDAVDAASTLENHTQNSSEVSPPSLNADKPLEESPSTPLAPSQSQDSVNEPCSQPSGDRSLQTTSPPVVAPGN
ENGLAVPVPLRKSRPVSMDARIQVAQEKQVAEQGGDLSPAANRSQKASQSRPNSSALETLGGEKLANGSLEPPAQAAPGPSKRDSDCSSLCTSESMDYGT
NLSTDLSLNKEMGSLSIKDPKLYKKTLKRTRKFVVDGVEVSITTSKIISEDEKKDEEMRFLRRQELRELRLLQKEEHRNQTQLSNKHELQLEQMHKRFEQ
EINAKKKFFDTELENLERQQKQQVEKMEQDHAVRRREEARRIRLEQDRDYTRFQEQLKLMKKEVKNEVEKLPRQQRKESMKQKMEEHTQKKQLLDRDFVA
KQKEDLELAMKRLTTDNRREICDKERECLMKKQELLRDREAALWEMEEHQLQERHQLV
KQQLKDQYFLQRHELLRKHEKEREQMQRYNQRMIEQLKVRQQ
QEK
ARLPKIQRSEGKTRMAMYKKSLHINGGGSAAEQREKIKQFSQQEEKRQKSERLQQQQKHENQMRDMLAQCESNMSELQQLQNEKCHLLVEHETQKLK
ALDESHNQNLKEWRDKLRPRKKALEEDLNQKKREQEMFFKLSEEAECPNPSTPSKAAKFFPYSSADAS



DME EC Prediction for this protein is: 2.7.11.1
Check another protein