Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
MPGEVKADPAALMASL1.2.1.36;Retinal dehydrogenase. 8
  • Gene: AL1A2
NLEIKYTKIFINNEWQNSESGR1.2.1.36;Retinal dehydrogenase. 32
  • Gene: AL1A2
TKIFINNEW1.2.1;With NAD(+) or NADP(+) as acceptor. 38 -
VYNPATG1.2.1;With NAD(+) or NADP(+) as acceptor. 57 -
AARLAFSLGSVWRRMDASERG1.2.1.36;Retinal dehydrogenase. 83
  • Gene: AL1A2
LLDKLADLVERDRA1.2.1.36;Retinal dehydrogenase. 105
  • Gene: AL1A2
LADLVERD1.2.1;With NAD(+) or NADP(+) as acceptor. 109 -
RYYAGWADK1.2.1;With NAD(+) or NADP(+) as acceptor. 148 -
GWADKIHG1.2.1;With NAD(+) or NADP(+) as acceptor. 152 -
RHEPIGV1.2.1;With NAD(+) or NADP(+) as acceptor. 173 -
QIIPWNFP1.2.1;With NAD(+) or NADP(+) as acceptor. 182 -
PWNFPLLM1.2.1;With NAD(+) or NADP(+) as acceptor. 185 -
KPAEQTPL1.2.1;With NAD(+) or NADP(+) as acceptor. 210 -
EAGFPPGV1.2.1;With NAD(+) or NADP(+) as acceptor. 228 -
GYGPTAG1.2.1;With NAD(+) or NADP(+) as acceptor. 241 -
GPTAGAAI1.2.1;With NAD(+) or NADP(+) as acceptor. 243 -
GAAIASH1.2.1;With NAD(+) or NADP(+) as acceptor. 247 -
GIDKIAFTGSTEVGKLIQEAAGRSNLKRVTLELGGKSPNI1.2.1.36;Retinal dehydrogenase. 255
  • Active Site E=Glutamic acid at location 286 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Gene: AL1A2
AAGRSNLK1.2.1;With NAD(+) or NADP(+) as acceptor. 274 -
VTLELGG1.2.1;With NAD(+) or NADP(+) as acceptor. 283
  • Active Site E=Glutamic acid at location 286 on the protein
  • Active Site Description: Proton acceptor (By similarity
TLELGGK1.2.1;With NAD(+) or NADP(+) as acceptor. 284
  • Active Site E=Glutamic acid at location 286 on the protein
  • Active Site Description: Proton acceptor (By similarity
FFNQGQCC1.2.1;With NAD(+) or NADP(+) as acceptor. 313 -
FVEESIY1.2.1;With NAD(+) or NADP(+) as acceptor. 327 -
RSVERAK1.2.1;With NAD(+) or NADP(+) as acceptor. 339 -
EGAKLECGG1.2.1;With NAD(+) or NADP(+) as acceptor. 381 -
EGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRIAKEEIFG1.2.1.36;Retinal dehydrogenase. 381
  • Gene: AL1A2
MRIAKEEIFGPV1.2.1;With NAD(+) or NADP(+) as acceptor. 411 -
AQSPFGG1.2.1;With NAD(+) or NADP(+) as acceptor. 479 -
PFGGFKMSGNGRE1.2.1;With NAD(+) or NADP(+) as acceptor. 482 -
GLREYSEVKTVT1.2.1.36;Retinal dehydrogenase. 499
  • Gene: AL1A2

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MTSSKIEMPGEVKADPAALMASLHLLPSPTPNLEIKYTKIFINNEWQNSESGRVFPVYNPATGEQVCEVQEADKADIDKAVQAARLAFSLGSVWRRMDAS
ERG
RLLDKLADLVERDRAVLATMESLNGGKPFLQAFYVDLQGVIKTFRYYAGWADKIHGMTIPVDGDYFTFTRHEPIGVCGQIIPWNFPLLMFAWKIAPA
LCCGNTVVI
KPAEQTPLSALYMGALIKEAGFPPGVINILPGYGPTAGAAIASHIGIDKIAFTGSTEVGKLIQEAAGRSNLKRVTLELGGKSPNIIFADAD
LDYAVEQAHQGV
FFNQGQCCTAGSRIFVEESIYEEFVRRSVERAKRRVVGSPFDPTTEQGPQIDKKQYNKILELIQSGVAEGAKLECGGKGLGRKGFFIE
PTVFSNVTDDMRIAKEEIFGPV
QEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALTVSSAMQAGTVWINCYNALNAQSPFGGFKMSGNGREMGEFGL
REYSEVKTVT
VKIPQKNS



DME EC Prediction for this protein is: 1.2.1.36
Check another protein