Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
VETLVVAD3.4.24.82;ADAMTS-4 endopeptidase. 220
  • Domain: Peptidase M12B
KHPSIRN3.4.24.82;ADAMTS-4 endopeptidase. 254
  • Domain: Peptidase M12B
PQVGPSAAQTLRSFC3.4.24.82;ADAMTS-4 endopeptidase. 279
  • Domain: Peptidase M12B
  • Gene: ATS4
WQRGLNTP3.4.24.82;ADAMTS-4 endopeptidase. 295
  • Domain: Peptidase M12B
  • Gene: ATS4
DTAILFTRQ3.4.24.82;ADAMTS-4 endopeptidase. 311
  • Domain: Peptidase M12B
CDTLGMADVGT3.4.24.82;ADAMTS-4 endopeptidase. 327
  • Domain: Peptidase M12B
AHELGHVF3.4.24.82;ADAMTS-4 endopeptidase. 360
  • Active Site E=Glutamic acid at location 362 on the protein
  • Active Site Description: By similarity.
  • Metal Site H=Histidine at location 361 on the protein
  • Metal Site Description: Zinc; catalytic (By similarity
  • Domain: Peptidase M12B
MLHDNSK3.4.24.82;ADAMTS-4 endopeptidase. 369
  • Metal Site H=Histidine at location 371 on the protein
  • Metal Site Description: Zinc; catalytic (By similarity
  • Domain: Peptidase M12B
  • Gene: ATS4
TFPGKDYDADRQCQLTFGPDS3.4.24.82;ADAMTS-4 endopeptidase. 437
  • Domain: Disintegrin
  • Gene: ATS4
DYDADRQ3.4.24;Metalloendopeptidases. 442 -
HCPQLPPPCAALWC3.4.24.82;ADAMTS-4 endopeptidase. 459
  • Domain: Disintegrin
  • Gene: ATS4
PQAGGWGPWG3.4.24.82;ADAMTS-4 endopeptidase. 518
  • Domain: Disintegrin
  • Gene: ATS4
PWGDCSR3.4.24.82;ADAMTS-4 endopeptidase. 528
  • Domain: TSP type-1
CSRTCGGGV3.4.24.82;ADAMTS-4 endopeptidase. 532
  • Domain: TSP type-1
PVPRNGGKYCEGRRT3.4.24.82;ADAMTS-4 endopeptidase. 550
  • Domain: TSP type-1
  • Gene: ATS4
LTFREEQCAAYNH3.4.24.82;ADAMTS-4 endopeptidase. 580
  • Gene: ATS4
SKKKFDKC3.4.24.82;ADAMTS-4 endopeptidase. 668 -
CSKQSGSF3.4.24.82;ADAMTS-4 endopeptidase. 685
  • Gene: ATS4
THILVRQQG3.4.24.82;ADAMTS-4 endopeptidase. 710
  • Gene: ATS4
TDVVLPGAVSLRYSG3.4.24.82;ADAMTS-4 endopeptidase. 749
  • Gene: ATS4
RYSFFVP3.4.24.82;ADAMTS-4 endopeptidase. 797 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MSQTGSHPGRGLAGRWLWGAQPCLLLPIVPLSWLVWLLLLLLASLLPSARLASPLPREEEIVFPEKLNGSVLPGSGAPARLLCRLQAFGETLLLELEQDS
GVQVEGLTVQYLGQAPELLGGAEPGTYLTGTINGDPESVASLHWDGGALLGVLQYRGAELHLQPLEGGTPNSAGGPGAHILRRKSPASGQGPMCNVKAPL
GSPSPRPRRAKRFASLSRF
VETLVVADDKMAAFHGAGLKRYLLTVMAAAAKAFKHPSIRNPVSLVVTRLVILGSGEEGPQVGPSAAQTLRSFCAWQRGLN
TP
EDSDPDHFDTAILFTRQDLCGVSTCDTLGMADVGTVCDPARSCAIVEDDGLQSAFTAAHELGHVFNMLHDNSKPCISLNGPLSTSRHVMAPVMAHVDP
EEPWSPCSARFITDFLDNGYGHCLLDKPEAPLHLPV
TFPGKDYDADRQCQLTFGPDSRHCPQLPPPCAALWCSGHLNGHAMCQTKHSPWADGTPCGPAQA
CMGGRCLHMDQLQDFNI
PQAGGWGPWGPWGDCSRTCGGGVQFSSRDCTRPVPRNGGKYCEGRRTRFRSCNTEDCPTGSALTFREEQCAAYNHRTDLFKSF
PGPMDWVPRYTGVAPQDQCKLTCQAQALGYYYVLEPRVVDGTPCSPDSSSVCVQGRCIHAGCDRIIG
SKKKFDKCMVCGGDGSGCSKQSGSFRKFRYGYN
NVVTIPAGA
THILVRQQGNPGHRSIYLALKLPDGSYALNGEYTLMPSPTDVVLPGAVSLRYSGATAASETLSGHGPLAQPLTLQVLVAGNPQDTRLRYSF
FVP
RPTPSTPRPTPQDWLHRRAQILEILRRRPWAGRK



DME EC Prediction for this protein is: 3.4.24.82
Check another protein