Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
EELTAVM1.4.3;With oxygen as acceptor. 62 -
FSVELQLP1.4.3;With oxygen as acceptor. 93 -
PPPAREALAI1.4.3;With oxygen as acceptor. 114 -
ELVVGPLP1.4.3;With oxygen as acceptor. 136 -
LHPVGLELL1.4.3;With oxygen as acceptor. 234 -
NYDYIWD1.4.3;With oxygen as acceptor. 464
  • Active Site Y=Tyrosine at location 465 on the protein
  • Active Site Description: Schiff-base intermediate with
PRYLYLA1.4.3;With oxygen as acceptor. 580 -
SWGRYQL1.4.3;With oxygen as acceptor. 622 -
DLVAWVT1.4.3;With oxygen as acceptor. 669
  • Metal Site D=Aspartic acid at location 669 on the protein
  • Metal Site Description: Calcium 1 (By similarity).
FLHIPHAEDIPNTVT1.4.3;With oxygen as acceptor. 678
  • Metal Site H=Histidine at location 680 on the protein
  • Metal Site Description: Copper (By similarity).

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MHLKIVLAFLALSLITIFALAYVLLTSPGGSSQPPHCPSVSHRAQPWPHPGQSQLFADLSREELTAVMRFLTQRLGPGLVDAAQAQPSDNCIFSVELQLP
PKAAALAHLDRGSPPPAREALAIVLFGGQPQPNVSELVVGPLPHPSYMRDVTVERHGGPLPYHRRPVLRAEFTQMWRHLKEVELPKAPIFLSSTFNYNGS
TLAAVHATPRGLRSGDRATWMALYHNISGVGLF
LHPVGLELLLDHRALDPAHWTVQQVFYLGHYYADLGQLEREFKSGRLEVVRVPLPPPNGASSLRSRN
SPGPLPPLQFSPQGSQYSVQGNLVVSSLWSFTFGHGVFSGLRIFDVRFQGERIAYEVSVQECVSIYGADSPKTMLTRYLDSSFGLGRNSRGLVRGVDCPY
QATMVDIHILVGKGAVQLLPGAVCVFEEAQGLPLRRHHNYLQNHFYGGLASSALVVRSVSSVG
NYDYIWDFVLYPNGALEGRVHATGYINTAFLKGGEEG
LLFGNRVGERVLGTVHTHAFHFKLDLDVAGLKNWVVAEDVVFKPVAAPWNPEHWLQRPQLTRQVLGKEDLTAFSLGSPL
PRYLYLASNQTNAWGHQRGYR
IQIHSPLGIHIPLESDMERAL
SWGRYQLVVTQRKEEESQSSSIYHQNDIWTPTVTFADFINNETLLGEDLVAWVTASFLHIPHAEDIPNTVTLGNRVGFL
LRPYNFFDEDPSIFSPGSVYFEKGQDAGLCSINPVACLPDLAACVPDLPPFSYHGF



DME EC Prediction for this protein is: 1.4.3
Check another protein