Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
PVYHNMFALMSETER2.7.10.2;Non-specific protein-tyrosine kinase. 79
  • Domain: FERM
  • Gene: JAK2
ETERIWYPPNHVFH2.7.10.2;Non-specific protein-tyrosine kinase. 90
  • Domain: FERM
  • Gene: JAK2
LYRIRFYFP2.7.10.2;Non-specific protein-tyrosine kinase. 113
  • Domain: FERM
VMSYLFAQWR2.7.10.2;Non-specific protein-tyrosine kinase. 149
  • Domain: FERM
  • Gene: JAK2
ECLGMAVL2.7.10.2;Non-specific protein-tyrosine kinase. 177
  • Domain: FERM
YHILTRKRIRYRFR2.7.10.2;Non-specific protein-tyrosine kinase. 221
  • Domain: FERM
  • Gene: JAK2
FEVKEPG2.7.10.2;Non-specific protein-tyrosine kinase. 270
  • Domain: FERM
  • Gene: JAK2
ITGNGGIQ2.7.10.2;Non-specific protein-tyrosine kinase. 290
  • Domain: FERM
  • Gene: JAK2
DVSIKQA2.7.10.2;Non-specific protein-tyrosine kinase. 325
  • Domain: FERM
DAHHYLC2.7.10.2;Non-specific protein-tyrosine kinase. 378
  • Domain: FERM
VLENIQSNCHGPI2.7.10.2;Non-specific protein-tyrosine kinase. 392
  • Gene: JAK2
KLKKAGNQTG2.7.10.2;Non-specific protein-tyrosine kinase. 412
  • Domain: SH2; atypical
  • Gene: JAK2
VLRCSPKDFNKYFLTFAVERENV2.7.10.2;Non-specific protein-tyrosine kinase. 424
  • Domain: SH2; atypical
  • Gene: JAK2
KCCPPKPKDKSNLLVFR2.7.10.2;Non-specific protein-tyrosine kinase. 497
  • Gene: JAK2
QMVFHKIRNEDLIF2.7.10.2;Non-specific protein-tyrosine kinase. 534
  • Gene: JAK2
ESLGQGTFTKIFKG2.7.10.2;Non-specific protein-tyrosine kinase. 549
  • Domain: Protein kinase
  • Gene: JAK2
EVGDYGQLH2.7.10.2;Non-specific protein-tyrosine kinase. 566
  • Domain: Protein kinase
  • Gene: JAK2
TEVLLKV2.7.10.2;Non-specific protein-tyrosine kinase. 576
  • Domain: Protein kinase
FFEAASMM2.7.10.2;Non-specific protein-tyrosine kinase. 594
  • Domain: Protein kinase
VKFGSLDTYLKKNKN2.7.10.2;Non-specific protein-tyrosine kinase. 629
  • Domain: Protein kinase
  • Gene: JAK2
PFIKLSDPG2.7.10.2;Non-specific protein-tyrosine kinase. 693
  • Domain: Protein kinase
ERIPWVPPECIENP2.7.10.2;Non-specific protein-tyrosine kinase. 714
  • Domain: Protein kinase
  • Gene: JAK2
FGTTLWEIC2.7.10.2;Non-specific protein-tyrosine kinase. 739
  • Domain: Protein kinase
CMDYEPDFRP2.7.10.2;Non-specific protein-tyrosine kinase. 787
  • Domain: Protein kinase
  • Gene: JAK2
FEERHLK2.7.10.2;Non-specific protein-tyrosine kinase. 844 -
QICKGMEYLG2.7.10.2;Non-specific protein-tyrosine kinase. 959
  • Domain: Protein kinase
HRDLATRN2.7.10;Protein-tyrosine kinases. 974
  • Active Site D=Aspartic acid at location 976 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
SPIFWYAPESL2.7.10.2;Non-specific protein-tyrosine kinase. 1016
  • Domain: Protein kinase
SDVWSFGVVLYELFTY2.7.10.2;Non-specific protein-tyrosine kinase. 1035
  • Domain: Protein kinase
EFMRMIGNDKQGQMIVFHLIELLK2.7.10.2;Non-specific protein-tyrosine kinase. 1060
  • Domain: Protein kinase
  • Gene: JAK2
NGRLPRP2.7.10.2;Non-specific protein-tyrosine kinase. 1085
  • Domain: Protein kinase
  • Gene: JAK2
ECWNNNV2.7.10.2;Non-specific protein-tyrosine kinase. 1104
  • Domain: Protein kinase
  • Gene: JAK2
QRPSFRDL2.7.10.2;Non-specific protein-tyrosine kinase. 1112
  • Domain: Protein kinase
  • Gene: JAK2

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MGMACLTMTEMEGTSTSSIYQNGDISGNANSMKQIDPVLQVYLYHSLGKSEADYLTFPSGEYVAEEICIAASKACGITPVYHNMFALMSETERIWYPPNH
VFH
IDESTRHNVLYRIRFYFPRWYCSGSNRAYRHGISRGAEAPLLDDFVMSYLFAQWRHDFVHGWIKVPVTHETQEECLGMAVLDMMRIAKENDQTPLAI
YNSISYKTFLPKCIRAKIQD
YHILTRKRIRYRFRRFIQQFSQCKATARNLKLKYLINLETLQSAFYTEKFEVKEPGSGPSGEEIFATIIITGNGGIQWSR
GKHKESETLTEQDLQLYCDFPNII
DVSIKQANQEGSNESRVVTIHKQDGKNLEIELSSLREALSFVSLIDGYYRLTADAHHYLCKEVAPPAVLENIQSNC
HGPI
SMDFAISKLKKAGNQTGLYVLRCSPKDFNKYFLTFAVERENVIEYKHCLITKNENEEYNLSGTKKNFSSLKDLLNCYQMETVRSDNIIFQFTKCCP
PKPKDKSNLLVFR
TNGVSDVPTSPTLQRPTHMNQMVFHKIRNEDLIFNESLGQGTFTKIFKGVRREVGDYGQLHETEVLLKVLDKAHRNYSESFFEAASM
M
SKLSHKHLVLNYGVCVCGDENILVQEFVKFGSLDTYLKKNKNCINILWKLEVAKQLAWAMHFLEENTLIHGNVCAKNILLIREEDRKTGNPPFIKLSDP
G
ISITVLPKDILQERIPWVPPECIENPKNLNLATDKWSFGTTLWEICSGGDKPLSALDSQRKLQFYEDRHQLPAPKWAELANLINNCMDYEPDFRPSFRA
IIRDLNSLFTPDYELLTENDMLPNMRIGALGFSGAFEDRDPTQ
FEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIE
ILKSLQHDNIVKYKGVCYSAGRRNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTS
QICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKV
LPQDKEYYKVKEPGE
SPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYM
IMT
ECWNNNVNQRPSFRDLALRVDQIRDNMAG



DME EC Prediction for this protein is: 2.7.10.2
Check another protein