Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
RRQKKLPQLFER4.6.1.1;Adenylate cyclase. 74
  • Gene: ADCY9
ERCFPQTQRRFRYAL4.6.1.1;Adenylate cyclase. 106
  • Gene: ADCY9
ADIVGFT4.6.1.1;Adenylate cyclase. 398
  • Metal Site D=Aspartic acid at location 399 on the protein
  • Metal Site Description: Magnesium 1 (By similarity).
  • Domain: Guanylate cyclase
DHAYCCIEMGLGMI4.6.1.1;Adenylate cyclase. 457
  • Gene: ADCY9
MRVGVHTGTVL4.6.1.1;Adenylate cyclase. 486 -
ADQLKGLKT4.6.1.1;Adenylate cyclase. 560
  • Gene: ADCY9
DQSALLPLRFKNIREKTDAHFV4.6.1.1;Adenylate cyclase. 708
  • Gene: ADCY9
FLLLLLVWFLNR4.6.1.1;Adenylate cyclase. 987
  • Gene: ADCY9
GVIFASIVNFSEFYEENYEGGKECYR4.6.1.1;Adenylate cyclase. 1058
  • Gene: ADCY9
EKIKTIG4.6.1.1;Adenylate cyclase. 1105
  • Domain: Guanylate cyclase
TYMAASGLN4.6.1.1;Adenylate cyclase. 1113
  • Domain: Guanylate cyclase
KMGYDFDYRGTVNVKGKGQMKTY4.6.1.1;Adenylate cyclase. 1218
  • Gene: ADCY9
ISPDIRVQVDGSIGRSPTDEI4.6.1.1;Adenylate cyclase. 1258
  • Gene: ADCY9

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MASPPHQQLLHHHSTEVSCDSSGDSNSVRVKINPKQLSSNSHPKHCKYSISSSCSSSGDSGGVPRRVGGGGRLRRQKKLPQLFERASSRWWDPKFDSVNL
EEACL
ERCFPQTQRRFRYALFYIGFACLLWSIYFAVHMRSRLIVMVAPALCFLLVCVGFFLFTFTKLYARHYAWTSLALTLLVFALTLAAQFQVLTPVSG
RGDSSNLTATARPTDTCLSQVGSFSMCIEVLFLLYTVMHLPLYLSLCLGVAYSVLFETFGYHFRDEACFPSPGAGALHWELLSRGLLHGCIHAIGVHLFV
MSQVRSRSTFLKVGQSIMHGKDLEVEKALKERMIHSVMPRIIADDLMKQGDEESENSVKRHATSSPKNRKKKSSIQKAPIAFRPFKMQQIEEVSILF
ADI
VGFT
KMSANKSAHALVGLLNDLFGRFDRLCEETKCEKISTLGDCYYCVAGCPEPRADHAYCCIEMGLGMIKAIEQFCQEKKEMVNMRVGVHTGTVLCGIL
GMRRFKFDVWSNDVNLANLMEQLGVAGKVHISEATAKYLDDRYEMEDGKVIERLGQSVV
ADQLKGLKTYLISGQRAKESRCSCAEALLSGFEVIDGSQVS
SGPRGQGTASSGNVSDLAQTVKTFDNLKTCPSCGITFAPKSEAGAEGGAPQNGCQDEHKNSTKASGGPNPKTQNGLLSPPQEEKLTNSQTSLCEILQEKG
RWAGVSL
DQSALLPLRFKNIREKTDAHFVDVIKEDSLMKDYFFKPPINQFSLNFLDQELERSYRTSYQEEVIKNSPVKTFASPTFSSLLDVFLSTTVFLT
LSTTCFLKYEAATVPPPPAALAVFSAALLLEVLSLAVSIRMVFFLEDVMACTKRLLEWIAGWLPRHCIGAILVSLPALAVYSHVTSEYETNIHFPVFTGS
AALIAVVHYCNFCQLSSWMRSSLATVVGAGPLLLLYVSLCPDSSVLTSPLDAVQNFSSERNPCNSSVPRDLRRPASLIGQEVVLVF
FLLLLLVWFLNREF
EVSYRLHYHGDVEADLHRTKIQSMRDQADWLLRNIIPYHVAEQLKVSQTYSKNHDSG
GVIFASIVNFSEFYEENYEGGKECYRVLNELIGDFDELLSKPD
YSSI
EKIKTIGATYMAASGLNTAQAQDGSHPQEHLQILFEFAKEMMRVVDDFNNNMLWFNFKLRVGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDTT
GVECRIQVSEESYRVLS
KMGYDFDYRGTVNVKGKGQMKTYLYPKCTDHRVIPQHQLSISPDIRVQVDGSIGRSPTDEIANLVPSVQYVDKTSLGSDSSTQ
AKDAHLSPKRPWKEPVKAEERGRFGKAIEKDDCDETGIEEANELTKLNVSKSV



DME EC Prediction for this protein is: 4.6.1.1
Check another protein