Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
ADIVGFT4.6.1.1;Adenylate cyclase. 323
  • Metal Site D=Aspartic acid at location 324 on the protein
  • Metal Site Description: Magnesium 1 (By similarity).
  • Domain: Guanylate cyclase
RIKILGDCYYC4.6.1.1;Adenylate cyclase. 362
  • Metal Site D=Aspartic acid at location 368 on the protein
  • Metal Site Description: Magnesium 1 (By similarity).
  • Domain: Guanylate cyclase
MRVGVHTGTVL4.6.1.1;Adenylate cyclase. 411 -
WQYDVWS4.6.1.1;Adenylate cyclase. 430 -
AGVIGARKP4.6.1.1;Adenylate cyclase. 1051
  • Domain: Guanylate cyclase
TVNVASR4.6.1.1;Adenylate cyclase. 1067
  • Domain: Guanylate cyclase
ASRMEST4.6.1;Lyases Phosphorus-oxygen lyases 1071
  • Domain: Guanylate cyclase

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MPRNQGFSEPEYSAEYSAEYSVSLPSDPDRGVGRTHEISVRNSGSCLCLPRFMRLTFVPESLENLYQTYFKRQRHETLLVLVVFAALFDCYVVVMCAVVF
SSDKLASLAVAGIGLVLDIILFVLCKKGLLPDRVTRRVLPYVLWLLITAQIFSYLGLNFARAHAASDTVGWQVFFVFSFFITLPLSLSPIVIISVVSCVV
HTLVLGVTVAQQQQEELKGMQLLREILANVFLYLCAIAVGIMSYYMADRKHRKAFLEARQSLEVKMNLEEQSQQQENLMLSILPKHVADEMLKDMKKDES
QKDQQQFNTMYMYRHENVSILF
ADIVGFTQLSSACSAQELVKLLNELFARFDKLAAKYHQLRIKILGDCYYCICGLPDYREDHAVCSILMGLAMVEAISY
VREKTKTGVD
MRVGVHTGTVLGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTMDCLKGEFDVEPGDGGSRCDYLEEKGIETYLIIASKPEVK
KTATQNGLNGSALPNGAPASSKSSSPALIETKEPNGSAHSSGSTSEKPEEQDAQADNPSFPNPRRRLRLQDLADRVVDASEDEHELNQLLNEALLERESA
QVVKKRNTFLLSMRFMDPEMETRYSVEKEKQSGAAFSCSCVVLLCTALVEILIDPWLMTNYVTFMVGEILLLILTICSLAAIFPRAFPKKLVAFSTWIDR
TRWARNTWAMLAIFILVMANVVDMLSCLQYYTGPSNATAGMETEGSCLENPKYYNYVAVLSLIATIMLVQVSHMVKLTLMLLVAGAVATINLYAWRPVFD
EYDHKRFREHDLPMVALEQMQGFNPGLNGTDRLPLVPSKYSMTVMVFLMMLSFYYFSRHVEKLARTLFLWKIEVHDQKERVYEMRRWNEALVTNMLPEHV
ARHFLGSKKRDEELYSQTYDEIGVMFASLPNFADFYTEESINNGGIECLRFLNEIISDFDSLLDNPKFRVITKIKTIGSTYMAASGVTPDVNTNGFASSN
KEDKSERERWQHLADLADFALAMKDTLTNINNQSFNNFMLRIGMNKGGVL
AGVIGARKPHYDIWGNTVNVASRMESTGVMGNIQVVEETQVILREYGFRF
VRRGPIFVKGKGELLTFFLKGRDKLATFPNGPSVTLPHQVVDNS



DME EC Prediction for this protein is: 4.6.1.1
Check another protein