Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
GRRSLSRSISQSSTDSYSSAASYTDSSDDE3.3.1.1;Adenosylhomocysteinase. 59 -
FGRREIEIAE3.3.1.1;Adenosylhomocysteinase. 115 -
LRKRAQGEKPLAGAKIVGCTHITAQTAVL3.3.1.1;Adenosylhomocysteinase. 133
  • Binding Site T=Threonine at location 155 on the protein
  • Binding site description: Substrate (By similarity).
QTAVLIETL3.3.1.1;Adenosylhomocysteinase. 157 -
ALGAQCRW3.3.1.1;Adenosylhomocysteinase. 167 -
ACNIYST3.3.1.1;Adenosylhomocysteinase. 176 -
VFAWKGE3.3.1.1;Adenosylhomocysteinase. 197 -
NMILDDGGD3.3.1.1;Adenosylhomocysteinase. 224
  • Binding Site D=Aspartic acid at location 229 on the protein
  • Binding site description: Substrate (By similarity).
LDDGGDLT3.3.1.1;Adenosylhomocysteinase. 227
  • Binding Site D=Aspartic acid at location 229 on the protein
  • Binding site description: Substrate (By similarity).
GIVEESVTGVHRLY3.3.1.1;Adenosylhomocysteinase. 250
  • Binding Site E=Glutamic acid at location 254 on the protein
  • Binding site description: Substrate (By similarity).
NVNDSVTK3.3.1.1;Adenosylhomocysteinase. 277 -
MFGGKQVVVCGYGEVGKGCCAALKA3.3.1.1;Adenosylhomocysteinase. 308 -
ITEIDPI3.3.1.1;Adenosylhomocysteinase. 339 -
EIDPICA3.3.1.1;Adenosylhomocysteinase. 341 -
DPICALQA3.3.1.1;Adenosylhomocysteinase. 343 -
QACMDGF3.3.1.1;Adenosylhomocysteinase. 349 -
VKLNEVIRQVD3.3.1.1;Adenosylhomocysteinase. 358 -
TPELTWERVRSQVDH3.3.1.1;Adenosylhomocysteinase. 411 -
TQALALIEL3.3.1.1;Adenosylhomocysteinase. 461 -
DVYLLPKKMDEYVASLHL3.3.1.1;Adenosylhomocysteinase. 480 -
QAKYLGL3.3.1.1;Adenosylhomocysteinase. 511 -
KNGPFKPN3.3.1.1;Adenosylhomocysteinase. 519 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MSMPDAMPLPGVGEELKQAKEIEDAEKYSFMATVTKAPKKQIQFADDMQEFTKFPTKTGRRSLSRSISQSSTDSYSSAASYTDSSDDEVSPREKQQTNSK
GSSNFCVKNIKQAE
FGRREIEIAEQDMSALISLRKRAQGEKPLAGAKIVGCTHITAQTAVLIETLCALGAQCRWSACNIYSTQNEVAAALAEAGVAVFAW
KGE
SEDDFWWCIDRCVNMDGWQANMILDDGGDLTHWVYKKYPNVFKKIRGIVEESVTGVHRLYQLSKAGKLCVPAMNVNDSVTKQKFDNLYCCRESILDG
LKRTTDV
MFGGKQVVVCGYGEVGKGCCAALKALGAIVYITEIDPICALQACMDGFRVVKLNEVIRQVDVVITCTGNKNVVTREHLDRMKNSCIVCNMGHS
NTEIDVTSLR
TPELTWERVRSQVDHVIWPDGKRVVLLAEGRLLNLSCSTVPTFVLSITATTQALALIELYNAPEGRYKQDVYLLPKKMDEYVASLHLPSF
DAHLTELTDD
QAKYLGLNKNGPFKPNYYRY



DME EC Prediction for this protein is: 3.3.1.1
Check another protein