Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
YQRYYSLQ1.14.11;With 2-oxoglutarate as one donor 116 -
DYWKNAAFLYGLGLVYF1.14.11;With 2-oxoglutarate as one donor 125 -
FCRAKEIHLRLG1.14.11;With 2-oxoglutarate as one donor 163 -
EIQFHIAHLYETQRKYHSAK1.14.11;With 2-oxoglutarate as one donor 206 -
DPNSGQSWYFLGRCYS1.14.11;With 2-oxoglutarate as one donor 280 -
IGKVQDAF1.14.11;With 2-oxoglutarate as one donor 297 -
SEASADTWCSIGVLYQQQNQP1.14.11;With 2-oxoglutarate as one donor 314 -
GTCDKVNNIHP1.14.11;With 2-oxoglutarate as one donor 795 -
ASSPSSAIST1.14.11;With 2-oxoglutarate as one donor 816 -
KLNPPTPSIYLE1.14.11;With 2-oxoglutarate as one donor 935 -
VEVRTQLLQPADENWDP1.14.11;With 2-oxoglutarate as one donor 998 -
SHTTIAKYAQYQA1.14.11;With 2-oxoglutarate as one donor 1028 -
SFQESLREENE1.14.11;With 2-oxoglutarate as one donor 1042 -
IKFGTNIDLSD1.14.11;With 2-oxoglutarate as one donor 1082 -
QRPGDLVWINAGTVHWVQA1.14.11;With 2-oxoglutarate as one donor 1212
  • Domain: JmjC
GWCNNIAWNVGPLTA1.14.11;With 2-oxoglutarate as one donor 1232
  • Domain: JmjC

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MKSCGVSLATAAAAAAAFGDEEKKMAAGKASGESEEASPSLTAEEREALGGLDSRLFGFVRFHEDGARTKALLGKAVRCYESLILKAEGKVESDFFCQLG
HFNLLLEDYPKALSA
YQRYYSLQSDYWKNAAFLYGLGLVYFHYNAFQWAIKAFQEVLYVDPSFCRAKEIHLRLGLMFKVNTDYESSLKHFQLALVDCNPC
TLSNA
EIQFHIAHLYETQRKYHSAKEAYEQLLQTENLSAQVKATVLQQLGWMHHTVDLLGDKATKESYAIQYLQKSLEADPNSGQSWYFLGRCYSSIGKV
QDAF
ISYRQSIDKSEASADTWCSIGVLYQQQNQPMDALQAYICAVQLDHGHAAAWMDLGTLYESCNQPQDAIKCYLNATRSKSCSNTSALAARIKYLQAQ
LCNLPQGSLQNKTKLLPSIEEAWSLPIPAELTSRQGAMNTAQQNTSDNWSGGHAVSHPPVQQQAHSWCLTPQKLQHLEQLRANRNNLNPAQKLMLEQLES
QFVLMQQHQMRPTGVAQVRSTGIPNGPTADSSLPTNSVSGQQPQLALTRVPSVSQPGVRPACPGQPLANGPFSAGHVPCSTSRTLGSTDTILIGNNHITG
SGSNGNVPYLQRNALTLPHNRTNLTSSAEEPWKNQLSNSTQGLHKGQSSHSAGPNGERPLSSTGPSQHLQAAGSGIQNQNGHPTLPSNSVTQGAALNHLS
SHTATSGGQQGITLTKESKPSGNILTVPETSRHTGETPNSTASVEGLPNHVHQMTADAVCSPSHGDSKSPGLLSSDNPQLSALLMGKANNNVGT
GTCDKV
NNIHP
AVHTKTDNSVASSPSSAISTATPSPKSTEQTTTNSVTSLNSPHSGLHTINGEGMEESQSPMKTDLLLVNHKPSPQIIPSMSVSIYPSSAEVLKAC
RNLGKNGLSNSSILLDKCPPPRPPSSPYPPLPKD
KLNPPTPSIYLENKRDAFFPPLHQFCTNPNNPVTVIRGLAGALKLDLGLFSTKTLVEANNEHMVEV
RTQLLQPADENWDP
TGTKKIWHCESNRSHTTIAKYAQYQASSFQESLREENEKRSHHKDHSDSESTSSDNSGRRRKGPFKTIKFGTNIDLSDDKKWKLQL
HELTKLPAFVRVVSAGNLLSHVGHTILGMNTVQLYMKVPGSRTPGHQENNNFCSVNINIGPGDCEWFVVPEGYWGVLNDFCEKNNLNFLMGSWWPNLEDL
YEANVPVYRFI
QRPGDLVWINAGTVHWVQAIGWCNNIAWNVGPLTACQYKLAVERYEWNKLQSVKSIVPMVHLSWNMARNIKVSDPKLFEMIKYCLLRTL
KQCQTLREALIAAGKEIIWHGRTKEEPAHYCSICEVEVFDLLFVTNESNSRKTYIVHCQDCARKTSGNLENFVVLEQYKMEDLMQVYDQFTLAPPLPSAS
S



DME EC Prediction for this protein is: 1.14.11
Check another protein