Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
KAKRVSRNKSEKKRRDQFNVLIKELGSMLPGNAR2.3.1.48;Histone acetyltransferase. 33
  • Gene: CLOCK
LEALDGFF2.3.1.48;Histone acetyltransferase. 115
  • Domain: PAS
SYEDRVC2.3.1.48;Histone acetyltransferase. 244
  • Gene: CLOCK
KSQDSGS2.3.1.48;Histone acetyltransferase. 402 -
HLPAHEKM2.3.1.48;Histone acetyltransferase. 466
  • Gene: CLOCK
QRRSSFSSQS2.3.1.48;Histone acetyltransferase. 475
  • Gene: CLOCK
GSVQLSSGNS2.3.1.48;Histone acetyltransferase. 577
  • Gene: CLOCK
PINMQGQVVPTNQIQSGMN2.3.1.48;Histone acetyltransferase. 594
  • Gene: CLOCK
LQSTSTQ2.3.1.48;Histone acetyltransferase. 628
  • Gene: CLOCK
VTTFTQDRQIRFSQGQQLVTKLVTAPVACGAVMVPSTM2.3.1.48;Histone acetyltransferase. 692
  • Gene: CLOCK
QQQSSQEQQL2.3.1.48;Histone acetyltransferase. 758
  • Gene: CLOCK
QPSQAQLTQ2.3.1.48;Histone acetyltransferase. 772
  • Gene: CLOCK
SHHQQHQSQQQQQLSRHRTDSL2.3.1.48;Histone acetyltransferase. 816
  • Gene: CLOCK

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MLFTVSCSKMSSIVDRDDSSIFDGLVEEDDKDKAKRVSRNKSEKKRRDQFNVLIKELGSMLPGNARKMDKSTVLQKSIDFLRKHKEITAQSDASEIRQDW
KPTFLSNEEFTQLM
LEALDGFFLAIMTDGSIIYVSESVTSLLEHLPSDLVDQSIFNFIPEGEHSEVYKILSTHLLESDSLTPEYLKSKNQLEFCCHMLRG
TIDPKEPSTYEYVKFIGNFKSLNSVSSSAHNGFEGTIQRTHRP
SYEDRVCFVATVRLATPQFIKEMCTVEEPNEEFTSRHSLEWKFLFLDHRAPPIIGYL
PFEVLGTSGYDYYHVDDLENLAKCHEHLMQYGKGKSCYYRFLTKGQQWIWLQTHYYITYHQWNSRPEFIVCTHTVVSYAEVRAERRRELGIEESLPETAA
D
KSQDSGSDNRINTVSLKEALERFDHSPTPSASSRSSRKSSHTAVSDPSSTPTKIPTDTSTPPRQHLPAHEKMVQRRSSFSSQSINSQSVGSSLTQPVMS
QATNLPIPQGMSQFQFSAQLGAMQHLKDQLEQRTRMIEANIHRQQEELRKIQEQLQMVHGQGLQMFLQQSNPGLNF
GSVQLSSGNSSNIQQLAPINMQGQ
VVPTNQIQSGMN
TGHIGTTQHMIQQQTLQSTSTQSQQNVLSGHSQQTSLPSQTQSTLTAPLYNTMVISQPAAGSMVQIPSSMPQNSTQSAAVTTFTQDRQ
IRFSQGQQLVTKLVTAPVACGAVMVPSTM
LMGQVVTAYPTFATQQQQSQTLSVTQQQQQQSSQEQQLTSVQQPSQAQLTQPPQQFLQTSRLLHGNPSTQL
ILSAAFPLQQSTFPQ
SHHQQHQSQQQQQLSRHRTDSLPDPSKVQPQ



DME EC Prediction for this protein is: 2.3.1.48
Check another protein