Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
NPVLIRRC1.13.11;With incorporation of two atoms of oxygen. 247
  • Domain: Lipoxygenase
TCSAKHAAV1.13.11.33;Arachidonate 15-lipoxygenase. 548
  • Metal Site H=Histidine at location 553 on the protein
  • Metal Site Description: Iron; catalytic (By similarity
  • Domain: Lipoxygenase
YPDEHFTE1.13.11.33;Arachidonate 15-lipoxygenase. 623
  • Domain: Lipoxygenase

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MAEFRVRVSTGEAFGAGTWDKVSVSIVGTRGESPPLPLDNLGKEFTAGAEEDFQVTLPEDVGRVLLLRVHKAPPVLPLLGPLAPDAWFCRWFQLTPPRGG
HLLFPCYQWLEGAGTLVLQEGTAKVSWADHHPVLQQQRQEELQARQEMYQWKAYNPGWPHCLDEKTVEDLELNIKYSTAKNANFYLQAGSAFAEMKIKGL
LDRKGLWRSLNEMKRIFNFRRTPAAEHAFEHWQEDAFFASQFLNGL
NPVLIRRCHYLPKNFPVTDAMVASVLGPGTSLQAELEKGSLFLVDHGILSGIQT
NVINGKPQFSAAPMTLLYQSPGCGPLLPLAIQLSQTPGPNSPIFLPTDDKWDWLLAKTWVRNAEFSFHEALTHLLHSHLLPEVFTLATLRQLPHCHPLFK
LLIPHTRYTLHINTLARELLIVPGQVVDRSTGIGIEGFSELIQRNMKQLNYSLLCLPEDIRTRGVEDIPGYYYRDDGMQIWGAVERFVSEIIGIYYPSDE
SVQDDRELQAWVREIFSKGFLNQESSGIPSSLETREALVQYVTMVIF
TCSAKHAAVSAGQFDSCAWMPNLPPSMQLPPPTSKGLATCEGFIATLPPVNAT
CDVILALWLLSKEPGDQRPLGT
YPDEHFTEEAPRRSIATFQSRLAQISRGIQERNQGLVLPYTYLDPPLIENSVSI



DME EC Prediction for this protein is: 1.13.11.33
Check another protein