Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
SNCDGLAG3.4.24.14;Procollagen N-endopeptidase. 163 -
DYNIEVLLGVDDSVV3.4.24.14;Procollagen N-endopeptidase. 255 -
EIYHDESLG3.4.24.14;Procollagen N-endopeptidase. 290
  • Domain: Peptidase M12B
HINVVLVR3.4.24.14;Procollagen N-endopeptidase. 300
  • Domain: Peptidase M12B
SLENVCRWA3.4.24.14;Procollagen N-endopeptidase. 328
  • Domain: Peptidase M12B
GYAPVTGMCHP3.4.24.14;Procollagen N-endopeptidase. 368
  • Domain: Peptidase M12B
LNHEDGFSSAFV3.4.24.14;Procollagen N-endopeptidase. 384
  • Domain: Peptidase M12B
AHETGHVLGMEHDGQGN3.4.24.14;Procollagen N-endopeptidase. 397
  • Active Site E=Glutamic acid at location 399 on the protein
  • Active Site Description: By similarity.
  • Metal Site H=Histidine at location 398 on the protein
  • Metal Site Description: Zinc; catalytic (By similarity
  • Domain: Peptidase M12B
HETGHVLG3.4.24;Metalloendopeptidases. 398
  • Active Site E=Glutamic acid at location 399 on the protein
  • Active Site Description: By similarity.
  • Metal Site H=Histidine at location 398 on the protein
  • Metal Site Description: Zinc; catalytic (By similarity
  • Domain: Peptidase M12B
MAPLVQAAFHR3.4.24.14;Procollagen N-endopeptidase. 425
  • Domain: Peptidase M12B
EQCRFDFG3.4.24.14;Procollagen N-endopeptidase. 480
  • Domain: Disintegrin
PCKQLWCSHPDNPYFCKTKKGPPLDGT3.4.24.14;Procollagen N-endopeptidase. 501
  • Domain: Disintegrin
DKCGVCGG3.4.24.14;Procollagen N-endopeptidase. 700 -
VCGGDNS3.4.24.14;Procollagen N-endopeptidase. 704 -
CSKPCGGG3.4.24.14;Procollagen N-endopeptidase. 857
  • Domain: TSP type-1
TKYGCRR3.4.24.14;Procollagen N-endopeptidase. 868
  • Domain: TSP type-1

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MVLLSLWLIAAALVEVRTSADGQAGNEEMVQIDLPIKRYREYELVTPVSTNLEGRYLSHTLSASHKKRSARDVSSNPEQLFFNITAFGKDFHLRLKPNTQ
LVAPGAVVEWHETSLVPGNITDPINNHQPGSATYRIRRTEPLQTNCAYVGDIVDIPGTSVAI
SNCDGLAGMIKSDNEEYFIEPLERGKQMEEEKGRIHVV
YKRSAVEQAPIDMSKDFHYRESDLEGLDDLGTVYGNIHQQLNETMRRRRHAGEN
DYNIEVLLGVDDSVVRFHGKEHVQNYLLTLMNIVNEIYHDESLGVH
INVVLVR
MIMLGYAKSISLIERGNPSRSLENVCRWASQQQRSDLNHSEHHDHAIFLTRQDFGPAGMQGYAPVTGMCHPVRSCTLNHEDGFSSAFVVAHET
GHVLGMEHDGQGN
RCGDETAMGSVMAPLVQAAFHRYHWSRCSGQELKRYIHSYDCLLDDPFDHDWPKLPELPGINYSMDEQCRFDFGVGYKMCTAFRTFD
PCKQLWCSHPDNPYFCKTKKGPPLDGTECAAGKWCYKGHCMWKNANQQKQDGNWGSWTKFGSCSRTCGTGVRFRTRQCNNPMPINGGQDCPGVNFEYQLC
NTEECQKHFEDFRAQQCQQRNSHFEYQNTKHHWLPYEHPDPKKRCHLYCQSKETGDVAYMKQLVHDGTHCSYKDPYSICVRGECVKVGCDKEIGSNKVE
D
KCGVCGGDNS
HCRTVKGTFTRTPRKLGYLKMFDIPPGARHVLIQEDEASPHILAIKNQATGHYILNGKGEEAKSRTFIDLGVEWDYNIEDDIESLHTDGP
LHDPVIVLIIPQENDTRSSLTYKYIIHEDSVPTINSNNVIQEELDTFEWALKSWSQ
CSKPCGGGFQYTKYGCRRKSDNKMVHRSFCEANKKPKPIRRMCN
IQECTHPLWVAEEWEHCTKTCGSSGYQLRTVRCLQPLLDGTNRSVHSKYCMGDRPESRRPCNRVPCPAQWKTGPWSECSVTCGEGTEVRQVLCRAGDHCD
GEKPESVRACQLPPCNDEPCLGDKSIFCQMEVLARYCSIPGYNKLCCESCSKRSSTLPPPYLLEAAETHDDVISNPSDLPRSLVMPTSLVPYHSETPAKK
MSLSSISSVGGPNAYAAFRPNSKPDGANLRQRSAQQAGSKTVRLVTVPSSPPTKRVHLSSASQMAAASFFAASDSIGASSQARTSKKDGKIIDNRRPTRS
STLER



DME EC Prediction for this protein is: 3.4.24.14
Check another protein