Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
MKERLGTGGFG2.7.11.10;I-kappa-B kinase. 17
  • Domain: Protein kinase
RLGTGGFGNV2.7.11.10;I-kappa-B kinase. 20
  • Domain: Protein kinase
PLLAMEYC2.7.11.10;I-kappa-B kinase. 92
  • Domain: Protein kinase
IIHRDLKPENIVLQ2.7.11.10;I-kappa-B kinase. 141
  • Active Site D=Aspartic acid at location 145 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
RDLKPEN2.7.11;Protein-serine/threonine kinases. 144
  • Active Site D=Aspartic acid at location 145 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
HKIIDLGYAK2.7.11.10;I-kappa-B kinase. 162
  • Domain: Protein kinase
DQGSLCTSFVGTLQYLAPEL2.7.11.10;I-kappa-B kinase. 174
  • Domain: Protein kinase
TVDYWSFGT2.7.11.10;I-kappa-B kinase. 202
  • Domain: Protein kinase
QGQRAAM2.7.11.10;I-kappa-B kinase. 449 -
QQLKAKL2.7.11.10;I-kappa-B kinase. 477
  • Domain: Leucine-zipper
QLSKTVVCKQKALELLPKVEEVV2.7.11.10;I-kappa-B kinase. 611
  • Gene: IKKB

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MSWSPSLTTQTCGAWEMKERLGTGGFGNVIRWHNQETGEQIAIKQCRQELSPRNRERWCLEIQIMRRLTHPNVVAARDVPEGMQNLAPNDLPLLAMEYCQ
GGDLRKYLNQFENCCGLREGAILTLLSDIASALRYLHENR
IIHRDLKPENIVLQQGEQRLIHKIIDLGYAKELDQGSLCTSFVGTLQYLAPELLEQQKYT
V
TVDYWSFGTLAFECITGFRPFLPNWQPVQWHSKVRQKSEVDIVVSEDLNGTVKFSSSLPYPNNLNSVLAERLEKWLQLMLMWHPRQRGTDPTYGPNGCF
KALDDILNLKLVHILNMVTGTIHTYPVTEDESLQSLKARIQQDTGIPEEDQELLQEAGLALIPDKPATQCISDGKLNEGHTLDMDLVFLFDNSKITYETQ
ISPRPQPESVSCILQEPKRNLAFFQLRKVWGQVWHSIQTLKEDCNRLQ
QGQRAAMMNLLRNNSCLSKMKNSMASMSQQLKAKLDFFKTSIQIDLEKYSEQ
TEFGITSDKLLLAWREMEQAVELCGRENEVKLLVERMMALQTDIVDLQRSPMGRKQGGTLDDLEEQARELYRRLREKPRDQRTEGDSQEMVRLLLQAIQS
FEKKVRVIYT
QLSKTVVCKQKALELLPKVEEVVSLMNEDEKTVVRLQEKRQKELWNLLKIACSKVRGPVSGSPDSMNASRLSQPGQLMSQPSTASNSLPE
PAKKSEELVAEAHNLCTLLENAIQDTVREQDQSFTALDWSWLQTEEEEHSCLEQAS



DME EC Prediction for this protein is: 2.7.11.10
Check another protein