Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
TEEAVAVKIVDM2.7.11.1;Non-specific serine/threonine protein kinase. 31
  • Binding Site K=Lysine at location 38 on the protein
  • Binding site description: ATP (By similarity).
  • Domain: Protein kinase
  • Gene: CHK1
DCPENIKKEICIN2.7.11.1;Non-specific serine/threonine protein kinase. 47
  • Domain: Protein kinase
  • Gene: CHK1
HENVVKFYGHRREG2.7.11.1;Non-specific serine/threonine protein kinase. 64
  • Domain: Protein kinase
  • Gene: CHK1
GGELFDR2.7.11;Protein-serine/threonine kinases. 89
  • Domain: Protein kinase
HRDIKPEN2.7.11;Protein-serine/threonine kinases. 128
  • Active Site D=Aspartic acid at location 130 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
KPENLLLDE2.7.11.1;Non-specific serine/threonine protein kinase. 132
  • Domain: Protein kinase
CGTLPYVAPE2.7.11.1;Non-specific serine/threonine protein kinase. 168
  • Domain: Protein kinase
  • Gene: CHK1
YVAPELL2.7.11;Protein-serine/threonine kinases. 173
  • Domain: Protein kinase
PVDVWSCGIVLTAMLAGELPWDQP2.7.11.1;Non-specific serine/threonine protein kinase. 188
  • Domain: Protein kinase
  • Gene: CHK1
VLTAMLAGELPWDQPSDSCQEYSDWKE2.7.11.1;Non-specific serine/threonine protein kinase. 197
  • Domain: Protein kinase
  • Gene: CHK1
KIDSAPLALLHKIL2.7.11.1;Non-specific serine/threonine protein kinase. 233
  • Domain: Protein kinase
  • Gene: CHK1
RITIPDIKKDRW2.7.11.1;Non-specific serine/threonine protein kinase. 253
  • Domain: Protein kinase
  • Gene: CHK1
WQRLVKRMTRFFTK2.7.11.1;Non-specific serine/threonine protein kinase. 370
  • Gene: CHK1
DRRNNKLIFK2.7.11.1;Non-specific serine/threonine protein kinase. 418
  • Gene: CHK1
DFRLSKGDGLEFKRHFLKIK2.7.11.1;Non-specific serine/threonine protein kinase. 440
  • Gene: CHK1

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MAVPFVEDWDLVQTLGEGAYGEVQLAVNRVTEEAVAVKIVDMKRAVDCPENIKKEICINKMLNHENVVKFYGHRREGNIQYLFLEYCSGGELFDRIEPDI
GMPEPDAQRFFHQLMAGVVYLHGIGIT
HRDIKPENLLLDERDNLKISDFGLATVFRYNNRERLLNKMCGTLPYVAPELLKRREFHAEPVDVWSCGIVLTA
MLAGELPWDQPSDSCQEYSDWKE
KKTYLNPWKKIDSAPLALLHKILVENPSARITIPDIKKDRWYNKPLKKGAKRPRVTSGGVSESPSGFSKHIQSNLDF
SPVNSASSEENVKYSSSQPEPRTGLSLWDTSPSYIDKLVQGISFSQPTCPDHMLLNSQLLGTPGSSQNP
WQRLVKRMTRFFTKLDADKSYQCLKETCEKL
GYQWKKSCMNQVTISTT
DRRNNKLIFKVNLLEMDDKILVDFRLSKGDGLEFKRHFLKIKGKLIDIVSSQKIWLPAT



DME EC Prediction for this protein is: 2.7.11.1
Check another protein