Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
YDTSHIYTG3.4.24.81;ADAM10 endopeptidase. 97
  • Gene: ADA10
IQTDHLF3.4.24.81;ADAM10 endopeptidase. 226
  • Domain: Peptidase M12B
  • Gene: ADA10
TDFSGIRNISFMVKRIRIN3.4.24.81;ADAM10 endopeptidase. 260
  • Domain: Peptidase M12B
  • Gene: ADA10
KLYSDGKKKSLNTGIITVQNYGSHVPPKVSHITFAHEVGH3.4.24.81;ADAM10 endopeptidase. 348
  • Active Site E=Glutamic acid at location 384 on the protein
  • Active Site Description: By similarity.
  • Metal Site H=Histidine at location 383 on the protein
  • Metal Site Description: Zinc; catalytic (By similarity
  • Domain: Peptidase M12B
  • Gene: ADA10
TSGDKLNNNKFS3.4.24.81;ADAM10 endopeptidase. 422
  • Domain: Peptidase M12B
  • Gene: ADA10
RNISQVL3.4.24;Metalloendopeptidases. 438 -
CFVESGQPICGNG3.4.24.81;ADAM10 endopeptidase. 451
  • Domain: Peptidase M12B
  • Gene: ADA10
GEECDCG3.4.24;Metalloendopeptidases. 468
  • Metal Site E=Glutamic acid at location 469 on the protein
  • Metal Site Description: Calcium 1.
  • Domain: Disintegrin
LKPGKQCSPSQGPCCT3.4.24.81;ADAM10 endopeptidase. 497
  • Domain: Disintegrin
  • Gene: ADA10
TALCPASDPKPNFTDCNRHTQVCINGQCAGSICEK3.4.24.81;ADAM10 endopeptidase. 540
  • Domain: Disintegrin
  • Gene: ADA10
TCASTGS3.4.24.81;ADAM10 endopeptidase. 606
  • Gene: ADA10
TITLQPGSPCN3.4.24.81;ADAM10 endopeptidase. 623
  • Gene: ADA10
GYCDVFMRCRLVDADGPLARLKKAIF3.4.24.81;ADAM10 endopeptidase. 637
  • Gene: ADA10
YQMGHMR3.4.24.81;ADAM10 endopeptidase. 741
  • Gene: ADA10

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MVLLRVLILLLSWAAGMGGQYGNPLNKYIRHYEGLSYNVDSLHQKHQRAKRAVSHEDQFLRLDFHAHGRHFNLRMKRDTSLFSDEFKVETSNKVLDYDTS
HIYTG
HIYGEEGSFSHGSVIDGRFEGFIQTRGGTFYVEPAERYIKDRTLPFHSVIYHEDDINYPHKYGPQGGCADHSVFERMRKYQMTGVEEVTQIPQEE
HAANGPELLRKKRTTSAEKNTCQLY
IQTDHLFFKYYGTREAVIAQISSHVKAIDTIYQTTDFSGIRNISFMVKRIRINTTADEKDPTNPFRFPNIGVEKF
LELNSEQNHDDYCLAYVFTDRDFDDGVLGLAWVGAPSGSSGGICEKS
KLYSDGKKKSLNTGIITVQNYGSHVPPKVSHITFAHEVGHNFGSPHDSGTECT
PGESKNLGQKENGNYIMYARA
TSGDKLNNNKFSLCSIRNISQVLEKKRNNCFVESGQPICGNGMVEQGEECDCGYSDQCKDECCFDANQPEGRKCKLKPG
KQCSPSQGPCCT
AQCAFKSKSEKCRDDSDCAREGICNGFTALCPASDPKPNFTDCNRHTQVCINGQCAGSICEKYGLEECTCASSDGKDDKELCHVCCMK
KMDPS
TCASTGSVQWSRHFSGRTITLQPGSPCNDFRGYCDVFMRCRLVDADGPLARLKKAIFSPELYENIAEWIVAHWWAVLLMGIALIMLMAGFIKICS
VHTPSSNPKLPPPKPLPGTLKRRRPPQPIQQPQRQRPRES
YQMGHMRR



DME EC Prediction for this protein is: 3.4.24.81
Check another protein